BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d14r (718 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42414| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_19951| Best HMM Match : SNF (HMM E-Value=0) 28 6.6 >SB_42414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 28.7 bits (61), Expect = 5.0 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 566 LSALYITCLSKYLLLCSAYEGFVYYIPFCTVPFIPLFRGINLPYAYGEL 712 ++ +++ LS +L+ A G+ Y IP C + L G +LP A L Sbjct: 203 VAVIWMAVLSYFLVWMVAIIGYTYTIPECVMGMTFLAAGSSLPDAIASL 251 >SB_19951| Best HMM Match : SNF (HMM E-Value=0) Length = 359 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 579 YNALNNGPFKDIKTIIVINISTNI 508 YN +N F+D T+ VIN ST++ Sbjct: 125 YNKFHNNCFRDAMTVSVINCSTSV 148 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,365,250 Number of Sequences: 59808 Number of extensions: 249104 Number of successful extensions: 362 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 339 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 360 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -