BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d13f (663 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43361| Best HMM Match : DUF841 (HMM E-Value=9.7e-07) 53 2e-07 SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_23867| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_33008| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_5584| Best HMM Match : p450 (HMM E-Value=1) 28 7.8 >SB_43361| Best HMM Match : DUF841 (HMM E-Value=9.7e-07) Length = 114 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = +2 Query: 221 LTWVLVYRTEKYQKLKVEVERQSKKLEKRKE 313 +T++LVYRT+KY+KLK EVE+ SKKLE+RKE Sbjct: 2 ITYILVYRTDKYKKLKAEVEKDSKKLERRKE 32 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 608 IRQNIQKLLGFAPSRAA 658 + N+QK LGFAPSRAA Sbjct: 84 LSMNVQKALGFAPSRAA 100 >SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 966 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -2 Query: 314 LPYVSLIFYSVVRLPLSVFDISPFCRLRPMLSLL 213 +P++ L+FY + P F + C+L P LSL+ Sbjct: 686 MPFI-LLFYETAKYPFGFFGSTAVCKLIPTLSLM 718 >SB_23867| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1152 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = +2 Query: 452 LSMFNSIFDGRVVAKLPFY--PISWIQGLSHRNLPGDDYTD-CSFIF 583 LS S+ GR V K+ P+SW++G + N PG ++ D SF+F Sbjct: 404 LSFKCSVLHGRAVNKMVTSKPPVSWVRGFHNFN-PGHEHLDQGSFVF 449 >SB_33008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1016 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = +2 Query: 227 WVLVYRTEKYQKLKVEVERQSKKLEKRKE 313 W+L Y+TE+ QK ++E E +K+L K ++ Sbjct: 846 WLLTYKTEQEQKREME-EDHNKRLTKARD 873 >SB_5584| Best HMM Match : p450 (HMM E-Value=1) Length = 286 Score = 27.9 bits (59), Expect = 7.8 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +2 Query: 200 TAFLGEGLTWVLVYRTE-KYQKLKVEVERQSKKLEKRKEAHG 322 TAF+ + V+R E KY + + ++E EKRK+AHG Sbjct: 69 TAFVADPKLVREVFRNEGKYPQREPQIELWMDYKEKRKQAHG 110 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,549,744 Number of Sequences: 59808 Number of extensions: 283775 Number of successful extensions: 742 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 742 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -