BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d12f (624 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC336.04 |cdc6|pol3, pold, mis10|DNA polymerase delta catalyti... 28 1.3 SPBC839.08c |its8||pig-N |Schizosaccharomyces pombe|chr 2|||Manual 27 1.7 SPCC70.10 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||M... 27 2.9 SPAC4F10.07c |atg13|apg13, mug78|autophagy associated protein At... 25 8.9 SPBC25H2.11c |||bromodomain protein|Schizosaccharomyces pombe|ch... 25 8.9 SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizos... 25 8.9 >SPBC336.04 |cdc6|pol3, pold, mis10|DNA polymerase delta catalytic subunit Cdc6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1086 Score = 27.9 bits (59), Expect = 1.3 Identities = 13/23 (56%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = +1 Query: 205 FGSAENRRSPF-SIFDTNPRILT 270 +G N +SPF IF TNPRIL+ Sbjct: 180 YGFQGNEKSPFIKIFTTNPRILS 202 >SPBC839.08c |its8||pig-N |Schizosaccharomyces pombe|chr 2|||Manual Length = 935 Score = 27.5 bits (58), Expect = 1.7 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 54 INKFCPKVVIILYICYLLHYF*IITRNFIYSINKK 158 I+ FC +IL+I L H I+ +N Y+I++K Sbjct: 899 ISHFCISNFLILFITALEHASAILCKNITYTIHEK 933 >SPCC70.10 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 155 Score = 26.6 bits (56), Expect = 2.9 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -3 Query: 577 PPYNGAALGTDTPQGESS 524 PPY+ AA ++TPQ E+S Sbjct: 112 PPYSPAATASNTPQNEAS 129 >SPAC4F10.07c |atg13|apg13, mug78|autophagy associated protein Atg13 |Schizosaccharomyces pombe|chr 1|||Manual Length = 758 Score = 25.0 bits (52), Expect = 8.9 Identities = 14/49 (28%), Positives = 22/49 (44%), Gaps = 3/49 (6%) Frame = +1 Query: 205 FGSAENRRSPFSIFDT---NPRILTEMAYQRAPTVVGVPNFNAVEDAAA 342 F S SP S FD +P++ R P+ + F+ + DAA+ Sbjct: 348 FKSPSLSASPGSNFDNMSISPKVAVNRYIHRGPSATSLNKFSMISDAAS 396 >SPBC25H2.11c |||bromodomain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 979 Score = 25.0 bits (52), Expect = 8.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 148 LIKRNCFFYNSHTVSP 195 LI NCF YNSH P Sbjct: 370 LIWSNCFLYNSHPDHP 385 >SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizosaccharomyces pombe|chr 1|||Manual Length = 927 Score = 25.0 bits (52), Expect = 8.9 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 605 TRVSSSVPIPSIQRCSSWHRYSSGGVI-RATITS 507 T V S+P+PSIQ S +G + R ++TS Sbjct: 375 TEVELSIPVPSIQEAESQKPVLTGSSMRRPSVTS 408 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,706,869 Number of Sequences: 5004 Number of extensions: 55385 Number of successful extensions: 140 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 140 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 275671126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -