BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d12f (624 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 23 2.4 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 4.2 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 5.6 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 7.4 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 23.0 bits (47), Expect = 2.4 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 74 SSDNPIYLLFITLFLNNNEKFY 139 ++D+ I I F N N+KFY Sbjct: 297 NNDDDIKSYLIQFFANKNQKFY 318 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.2 bits (45), Expect = 4.2 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 7/71 (9%) Frame = +2 Query: 62 ILS*SSDNPIYLLFITLFLNNNEKFYIQH**KEIVFSTT-----VIQCHQVRNLD--PLK 220 I S +NP + +F NN K Y + E+ F+ V H + +D P+K Sbjct: 23 IASPQLNNPTLFMIGGVFSNNKSKKYFEQTLNELNFNLNYVNKGVTYKHTIIEMDSNPIK 82 Query: 221 TADHLSLFLIQ 253 TA + LI+ Sbjct: 83 TALSVCKSLIE 93 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 5.6 Identities = 7/23 (30%), Positives = 11/23 (47%) Frame = -2 Query: 437 CDMACRCMLDLVVNISMIACSSV 369 C C+C D N + + CS + Sbjct: 761 CPAGCKCYNDRTWNTNAVDCSGL 783 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 402 SQYINDRLLVCTKALHGGPQ 343 S Y N L CT GGPQ Sbjct: 6 SMYNNVSPLQCTSPFLGGPQ 25 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,898 Number of Sequences: 438 Number of extensions: 3995 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18582456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -