BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d09f (645 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 27 0.17 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.71 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 2.8 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 21 6.6 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 26.6 bits (56), Expect = 0.17 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +1 Query: 139 LPRCQRWRCPQWPWHLANYMSQPPTKLPRSPPSSKRGSLEPRP 267 +P C W + + PPT PR S+R PRP Sbjct: 228 VPECADWYKGRLTDEQLKELENPPTPKPRPTKVSRRKPRPPRP 270 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 24.6 bits (51), Expect = 0.71 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = -1 Query: 309 HQCSRHDQSLLDQPWARLQGSSLRGWWRSRQLCGWLRHVVCE 184 H C+ + + +L + + L W + R++C W + CE Sbjct: 1113 HNCNAYYRCVLGELRKQYCAGGLH-WNKERKICDWPKSAKCE 1153 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 22.6 bits (46), Expect = 2.8 Identities = 7/26 (26%), Positives = 16/26 (61%) Frame = +3 Query: 333 LKNIQAEEMVEFSSGLKGMALNLEPD 410 +KN +++F+ GLK + +++ D Sbjct: 575 IKNFNIPSILQFNDGLKNLEIHVTKD 600 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 631 RTDTRGMIPGALIPTLIRDFVSI 563 R +RG+IP A + T+ FV + Sbjct: 235 RASSRGLIPRAKVKTIKITFVIV 257 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -2 Query: 617 GNDTWRLNTDPHTGFRVDWSLAINRVTQS 531 G D W G+RV++S A + T + Sbjct: 838 GEDRWLCTLLLQRGYRVEYSAASDAYTHA 866 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -2 Query: 617 GNDTWRLNTDPHTGFRVDWSLAINRVTQS 531 G D W G+RV++S A + T + Sbjct: 838 GEDRWLCTLLLQRGYRVEYSAASDAYTHA 866 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -2 Query: 617 GNDTWRLNTDPHTGFRVDWSLAINRVTQS 531 G D W G+RV++S A + T + Sbjct: 838 GEDRWLCTLLLQRGYRVEYSAASDAYTHA 866 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -2 Query: 617 GNDTWRLNTDPHTGFRVDWSLAINRVTQS 531 G D W G+RV++S A + T + Sbjct: 838 GEDRWLCTLLLQRGYRVEYSAASDAYTHA 866 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,980 Number of Sequences: 336 Number of extensions: 3533 Number of successful extensions: 14 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16552695 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -