BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d09f (645 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 25 0.83 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 25 0.83 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.4 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 22 4.4 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 5.8 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 5.8 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 7.7 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 24.6 bits (51), Expect = 0.83 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -2 Query: 608 TWRLNTDPHTGFRVDWSLAINR 543 T +L+TDP+T F+V+ S I R Sbjct: 680 TEKLSTDPNTHFQVNQSHGIKR 701 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -2 Query: 527 YYTPKDLLSDGNVYDSTSTLDNISFLDK 444 +Y P+DL ++Y++ L+ SF K Sbjct: 346 FYHPEDLPFIKDIYETVIKLEGASFRSK 373 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 24.6 bits (51), Expect = 0.83 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 Query: 8 SGSTATSRERSNWLSVCHNYKFVKNVADLRSY 103 S S S+ WL V NYK + A R Y Sbjct: 431 STSAGFSQTNKTWLPVNENYKSLNLAAQKREY 462 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.8 bits (49), Expect = 1.4 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = +3 Query: 3 SFPVLPQRVASGVTGFPSATIISL*KMSLISARIAGSVARRLPNAATQVS 152 S+P +SGV A +S+ +S+I+AR AG NAA S Sbjct: 619 SYPGEEMGGSSGVLAKKVADRVSMLMISVITARHAGEYVCTAENAAGTAS 668 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -2 Query: 527 YYTPKDLLSDGNVYDSTSTLDNISFLDK 444 +Y P+DL ++Y++ L+ SF K Sbjct: 52 FYHPEDLPFIKDIYETVIKLEGASFRSK 79 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +2 Query: 8 SGSTATSRERSNWLSVCHNYKFVKNVAD 91 S S S + WL V NYK V A+ Sbjct: 425 SVSAGFSSSSNTWLRVNENYKTVNLAAE 452 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +2 Query: 8 SGSTATSRERSNWLSVCHNYKFVKNVAD 91 S S S + WL V NYK V A+ Sbjct: 425 SVSAGFSSSSNTWLRVNENYKTVNLAAE 452 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 345 GCSSSHKHERYHHQCSRHDQS 283 G S H++ HH S H Q+ Sbjct: 804 GDQSQPPHQQLHHHQSTHPQA 824 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,018 Number of Sequences: 438 Number of extensions: 4362 Number of successful extensions: 18 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19438227 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -