BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d07f (589 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g46580.1 68418.m05735 pentatricopeptide (PPR) repeat-containi... 28 4.0 At5g24040.1 68418.m02824 F-box family protein similar to unknown... 28 4.0 At5g37020.1 68418.m04440 auxin-responsive factor (ARF8) identica... 27 7.0 >At5g46580.1 68418.m05735 pentatricopeptide (PPR) repeat-containing protein contains similarity to 67kD chloroplastic RNA-binding protein, P67.1 [Raphanus sativus] GI:9755886; contains Pfam profile PF01535: PPR repeat Length = 711 Score = 28.3 bits (60), Expect = 4.0 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 5/53 (9%) Frame = +3 Query: 213 IEASKDCYTNMKAYENFMMMYKVGFLPKNLEFSIF---YEKMR--EEAIALFK 356 I +K C KA E F MYK G +P + +S Y K EE ++L++ Sbjct: 228 ITCAKRCNLYNKAIEWFERMYKTGLMPDEVTYSAILDVYSKSGKVEEVLSLYE 280 >At5g24040.1 68418.m02824 F-box family protein similar to unknown protein (gb|AAD22308.1) ; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 373 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = -3 Query: 398 CFVETFKIFGIIEQLEQRDGFFPHFFVKDREFQILGKES 282 C+ E F++F I + E+R GF K+ E+ ILGK S Sbjct: 137 CYSEWFELFECISKCEERIGFMGLNREKN-EYMILGKLS 174 >At5g37020.1 68418.m04440 auxin-responsive factor (ARF8) identical to auxin response factor 8 GI:4104931 from [Arabidopsis thaliana] Length = 811 Score = 27.5 bits (58), Expect = 7.0 Identities = 13/37 (35%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = +3 Query: 255 ENFMMMYKVGFLPKNLEFSIF--YEKMREEAIALFKL 359 +NF+ +YK G + ++L+ S F Y ++REE +F + Sbjct: 705 KNFVKVYKSGSVGRSLDISRFSSYHELREELGKMFAI 741 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,914,884 Number of Sequences: 28952 Number of extensions: 231634 Number of successful extensions: 686 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 668 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 686 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1161268208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -