BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d05r (488 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 25 1.1 U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. 25 1.8 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 24 3.2 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 24 3.2 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 24 3.2 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 24 3.2 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 24 3.2 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 24 3.2 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 24 3.2 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 24 3.2 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 24 3.2 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 24 3.2 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 24 3.2 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 24 3.2 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 24 3.2 AY062204-1|AAL58565.1| 150|Anopheles gambiae cytochrome P450 CY... 23 5.6 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 23 7.4 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 22 9.8 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 25.4 bits (53), Expect = 1.1 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = -2 Query: 112 YINLDKPGDHSCGYCGLRFIKK 47 + N+ +P H C CG +F ++ Sbjct: 914 HANIHRPQSHECPVCGQKFTRR 935 >U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. Length = 278 Score = 24.6 bits (51), Expect = 1.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 168 VTSLGGISAIKFTAQFGFTCFG 233 VT GG+ +FT G CFG Sbjct: 210 VTVRGGVKGYRFTTVPGCVCFG 231 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.8 bits (49), Expect = 3.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 428 ILKSQIIKLIRHE*ISNYDFMFEIKD 351 I + IIK + H +NY+F + + D Sbjct: 75 IAQPTIIKSVEHHAPANYEFSYSVHD 100 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.8 bits (49), Expect = 3.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 428 ILKSQIIKLIRHE*ISNYDFMFEIKD 351 I + IIK + H +NY+F + + D Sbjct: 67 IAQPTIIKSVEHHAPANYEFSYSVHD 92 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 3.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 428 ILKSQIIKLIRHE*ISNYDFMFEIKD 351 I + IIK + H +NY+F + + D Sbjct: 67 IAQPTIIKSVEHHAPANYEFSYSVHD 92 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.8 bits (49), Expect = 3.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 428 ILKSQIIKLIRHE*ISNYDFMFEIKD 351 I + IIK + H +NY+F + + D Sbjct: 67 IAQPTIIKSVEHHAPANYEFSYSVHD 92 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.8 bits (49), Expect = 3.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 428 ILKSQIIKLIRHE*ISNYDFMFEIKD 351 I + IIK + H +NY+F + + D Sbjct: 75 IAQPTIIKSVEHHAPANYEFSYSVHD 100 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 3.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 428 ILKSQIIKLIRHE*ISNYDFMFEIKD 351 I + IIK + H +NY+F + + D Sbjct: 67 IAQPTIIKSVEHHAPANYEFSYSVHD 92 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.8 bits (49), Expect = 3.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 428 ILKSQIIKLIRHE*ISNYDFMFEIKD 351 I + IIK + H +NY+F + + D Sbjct: 75 IAQPTIIKSVEHHAPANYEFSYSVHD 100 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.8 bits (49), Expect = 3.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 428 ILKSQIIKLIRHE*ISNYDFMFEIKD 351 I + IIK + H +NY+F + + D Sbjct: 99 IAQPTIIKSVEHHAPANYEFSYSVHD 124 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 3.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 428 ILKSQIIKLIRHE*ISNYDFMFEIKD 351 I + IIK + H +NY+F + + D Sbjct: 67 IAQPTIIKSVEHHAPANYEFSYSVHD 92 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.8 bits (49), Expect = 3.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 428 ILKSQIIKLIRHE*ISNYDFMFEIKD 351 I + IIK + H +NY+F + + D Sbjct: 75 IAQPTIIKSVEHHAPANYEFSYSVHD 100 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.8 bits (49), Expect = 3.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 428 ILKSQIIKLIRHE*ISNYDFMFEIKD 351 I + IIK + H +NY+F + + D Sbjct: 67 IAQPTIIKSVEHHAPANYEFSYSVHD 92 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.8 bits (49), Expect = 3.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 428 ILKSQIIKLIRHE*ISNYDFMFEIKD 351 I + IIK + H +NY+F + + D Sbjct: 75 IAQPTIIKSVEHHAPANYEFSYSVHD 100 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.8 bits (49), Expect = 3.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 428 ILKSQIIKLIRHE*ISNYDFMFEIKD 351 I + IIK + H +NY+F + + D Sbjct: 67 IAQPTIIKSVEHHAPANYEFSYSVHD 92 >AY062204-1|AAL58565.1| 150|Anopheles gambiae cytochrome P450 CYP4C28 protein. Length = 150 Score = 23.0 bits (47), Expect = 5.6 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 358 LKMLRSTPVLCRTLTNKIEDISTH 287 L++ S P+L RTLT + DI H Sbjct: 69 LRLFPSIPILSRTLTTGV-DIEGH 91 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 22.6 bits (46), Expect = 7.4 Identities = 7/26 (26%), Positives = 14/26 (53%) Frame = +2 Query: 269 IPFLACMSRNIFNLVRQSST*YWCTS 346 +P LAC N+ N ++ +W ++ Sbjct: 857 LPILACGQNNVCNYASRNDRTFWLST 882 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 22.2 bits (45), Expect = 9.8 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = -2 Query: 304 EDISTHTGQKWDSDDYRLVRFTNAPKQVNPNWAVN 200 +D+ T ++ + D ++ T P + NP WAV+ Sbjct: 75 QDLVLQTARQMEVD-VLVLSHTYRPPENNPRWAVD 108 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 470,448 Number of Sequences: 2352 Number of extensions: 8627 Number of successful extensions: 28 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43131618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -