BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d03f (629 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 26 0.86 AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homoc... 23 8.0 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 26.2 bits (55), Expect = 0.86 Identities = 14/49 (28%), Positives = 22/49 (44%) Frame = +1 Query: 376 HGNPSTGCCAVIETSADGDDSEKRNGSISEAERHCHRSRNEEIDKRARR 522 +G+PST C A G+ +G+ E EEID++ R+ Sbjct: 362 NGSPSTSCGAPPALLGSGEGGSGTHGTDGGGEFQRSYDDEEEIDRKLRQ 410 >AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homocysteine hydrolase protein. Length = 432 Score = 23.0 bits (47), Expect = 8.0 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = +1 Query: 265 GNRDMVSGQLNINGYNDGHVSYGTDNQIRGRRVIFCVHGNPSTGCCAVIET 417 G +++V + + G YG +RG R+ C+H T +IET Sbjct: 17 GRKEIVLAENEMPGLMACRQKYGPLKILRGARIAGCLHMTIQT--AVLIET 65 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.315 0.132 0.376 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 618,659 Number of Sequences: 2352 Number of extensions: 11913 Number of successful extensions: 28 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61468785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -