BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d02r (757 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U55374-7|AAP82641.1| 286|Caenorhabditis elegans Uncoordinated p... 29 2.7 U55374-6|AAM69092.1| 1926|Caenorhabditis elegans Uncoordinated p... 29 2.7 U55374-5|AAP82640.2| 2027|Caenorhabditis elegans Uncoordinated p... 29 2.7 AY264781-1|AAP13107.1| 2027|Caenorhabditis elegans high voltage ... 29 2.7 AC006708-12|AAT81173.1| 908|Caenorhabditis elegans Hypothetical... 29 4.7 AC006708-11|AAF60426.2| 1019|Caenorhabditis elegans Hypothetical... 29 4.7 >U55374-7|AAP82641.1| 286|Caenorhabditis elegans Uncoordinated protein 2, isoform d protein. Length = 286 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = +1 Query: 577 LIRRNKFKNKPLCKKESTFQYSFNTQNRHRRHTEQHSRPILYYH--SFIKHQLY 732 +IRRN++ + QY + Q + + H +QHS+ + + H ++ H Y Sbjct: 39 IIRRNRYNTMEHSRSSHDPQYHQDQQQQQQPHHQQHSQHLQHSHHKTYQNHNQY 92 >U55374-6|AAM69092.1| 1926|Caenorhabditis elegans Uncoordinated protein 2, isoform c protein. Length = 1926 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = +1 Query: 577 LIRRNKFKNKPLCKKESTFQYSFNTQNRHRRHTEQHSRPILYYH--SFIKHQLY 732 +IRRN++ + QY + Q + + H +QHS+ + + H ++ H Y Sbjct: 1679 IIRRNRYNTMEHSRSSHDPQYHQDQQQQQQPHHQQHSQHLQHSHHKTYQNHNQY 1732 >U55374-5|AAP82640.2| 2027|Caenorhabditis elegans Uncoordinated protein 2, isoform b protein. Length = 2027 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = +1 Query: 577 LIRRNKFKNKPLCKKESTFQYSFNTQNRHRRHTEQHSRPILYYH--SFIKHQLY 732 +IRRN++ + QY + Q + + H +QHS+ + + H ++ H Y Sbjct: 1780 IIRRNRYNTMEHSRSSHDPQYHQDQQQQQQPHHQQHSQHLQHSHHKTYQNHNQY 1833 >AY264781-1|AAP13107.1| 2027|Caenorhabditis elegans high voltage activated calciumchannel alpha-1 subunit protein. Length = 2027 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = +1 Query: 577 LIRRNKFKNKPLCKKESTFQYSFNTQNRHRRHTEQHSRPILYYH--SFIKHQLY 732 +IRRN++ + QY + Q + + H +QHS+ + + H ++ H Y Sbjct: 1780 IIRRNRYNTMEHSRSSHDPQYHQDQQQQQQPHHQQHSQHLQHSHHKTYQNHNQY 1833 >AC006708-12|AAT81173.1| 908|Caenorhabditis elegans Hypothetical protein Y110A7A.9b protein. Length = 908 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 568 NTTLIRRNKFKNKPLCKKESTFQYSFNTQNRHRRHTE 678 NT + KN+P+ +KE F Y ++ N R+H E Sbjct: 592 NTLRFVVSNTKNQPILEKEIPFLYKDDSMNNVRKHLE 628 >AC006708-11|AAF60426.2| 1019|Caenorhabditis elegans Hypothetical protein Y110A7A.9a protein. Length = 1019 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 568 NTTLIRRNKFKNKPLCKKESTFQYSFNTQNRHRRHTE 678 NT + KN+P+ +KE F Y ++ N R+H E Sbjct: 703 NTLRFVVSNTKNQPILEKEIPFLYKDDSMNNVRKHLE 739 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,606,544 Number of Sequences: 27780 Number of extensions: 280394 Number of successful extensions: 537 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 527 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 537 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1798543458 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -