BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d02r (757 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44730.1 68416.m04814 kinesin motor protein-related similar t... 32 0.47 At5g17410.2 68418.m02043 tubulin family protein similar to spind... 29 3.3 At5g17410.1 68418.m02042 tubulin family protein similar to spind... 29 3.3 At1g03780.2 68414.m00358 targeting protein-related similar to mi... 29 4.4 At1g03780.1 68414.m00359 targeting protein-related similar to mi... 29 4.4 >At3g44730.1 68416.m04814 kinesin motor protein-related similar to 4 other kinesin-like proteins of A. thaliana: F02P16.12 (PID:g2191180), katA (D11371), katB (D21137), and katC (D21138); contains non-consensus AT-AC splice sites at intron 10 Length = 1087 Score = 31.9 bits (69), Expect = 0.47 Identities = 17/69 (24%), Positives = 30/69 (43%), Gaps = 1/69 (1%) Frame = +1 Query: 535 TIRDKNSSCIPNTTLIRRNKFKNK-PLCKKESTFQYSFNTQNRHRRHTEQHSRPILYYHS 711 TI+ +N + + R F + P+ K ST + + +N HR HT+ S + Sbjct: 841 TIKSRNKPDVTQNLPVSRTPFPARVPVVKSFSTVPLNPSAENNHRLHTDNSSEAFQNHQK 900 Query: 712 FIKHQLYXE 738 +L+ E Sbjct: 901 LSARKLFPE 909 >At5g17410.2 68418.m02043 tubulin family protein similar to spindle pole body protein [Homo sapiens][GI:2801701][PMID:9566967], gamma-tubulin ring protein Dgrip84 [Drosophila melanogaster][GI:4689225][PMID: 10037793] Length = 679 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/42 (26%), Positives = 26/42 (61%) Frame = -3 Query: 131 GTINWLENKCSSMI*KNSIRNVXTRNTKCLDDSTSTSVERXI 6 G +N L+++ +M NS+R++ + T+C ++ + +ER + Sbjct: 206 GVLNLLQSQAKAMAGDNSVRSLLEKMTECASNAYLSILERWV 247 >At5g17410.1 68418.m02042 tubulin family protein similar to spindle pole body protein [Homo sapiens][GI:2801701][PMID:9566967], gamma-tubulin ring protein Dgrip84 [Drosophila melanogaster][GI:4689225][PMID: 10037793] Length = 678 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/42 (26%), Positives = 26/42 (61%) Frame = -3 Query: 131 GTINWLENKCSSMI*KNSIRNVXTRNTKCLDDSTSTSVERXI 6 G +N L+++ +M NS+R++ + T+C ++ + +ER + Sbjct: 205 GVLNLLQSQAKAMAGDNSVRSLLEKMTECASNAYLSILERWV 246 >At1g03780.2 68414.m00358 targeting protein-related similar to microtubule-associated protein / targeting protein for Xklp2 ((TPX2) GI:8926138) {Homo sapiens}; similar to Restricted expression proliferation associated protein 100 (p100) (Differentially expressed in lung cells 2) (DIL-2) (Targeting protein for Xklp2) (C20orf1 protein) (C20orf2 protein) (Protein FLS353)(SP:Q9ULW0) {Homo sapiens} Length = 725 Score = 28.7 bits (61), Expect = 4.4 Identities = 19/64 (29%), Positives = 31/64 (48%) Frame = +1 Query: 538 IRDKNSSCIPNTTLIRRNKFKNKPLCKKESTFQYSFNTQNRHRRHTEQHSRPILYYHSFI 717 +R K+S+ + L + KFK +P+ KKE Q + N+H + S + H+ Sbjct: 334 LRVKSSAELEEEMLAKIPKFKARPVNKKEFHLQ-TMARANQHAETSSIASTEVSKQHNDQ 392 Query: 718 KHQL 729 KH L Sbjct: 393 KHHL 396 >At1g03780.1 68414.m00359 targeting protein-related similar to microtubule-associated protein / targeting protein for Xklp2 ((TPX2) GI:8926138) {Homo sapiens}; similar to Restricted expression proliferation associated protein 100 (p100) (Differentially expressed in lung cells 2) (DIL-2) (Targeting protein for Xklp2) (C20orf1 protein) (C20orf2 protein) (Protein FLS353)(SP:Q9ULW0) {Homo sapiens} Length = 687 Score = 28.7 bits (61), Expect = 4.4 Identities = 19/64 (29%), Positives = 31/64 (48%) Frame = +1 Query: 538 IRDKNSSCIPNTTLIRRNKFKNKPLCKKESTFQYSFNTQNRHRRHTEQHSRPILYYHSFI 717 +R K+S+ + L + KFK +P+ KKE Q + N+H + S + H+ Sbjct: 334 LRVKSSAELEEEMLAKIPKFKARPVNKKEFHLQ-TMARANQHAETSSIASTEVSKQHNDQ 392 Query: 718 KHQL 729 KH L Sbjct: 393 KHHL 396 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,382,068 Number of Sequences: 28952 Number of extensions: 244497 Number of successful extensions: 407 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 407 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1682736544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -