BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d02f (564 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22A12.14c |||BSD domain protein, unknown biological role|Sch... 31 0.088 SPCC1919.12c |||aminopeptidase |Schizosaccharomyces pombe|chr 3|... 25 7.7 >SPAC22A12.14c |||BSD domain protein, unknown biological role|Schizosaccharomyces pombe|chr 1|||Manual Length = 347 Score = 31.5 bits (68), Expect = 0.088 Identities = 10/36 (27%), Positives = 22/36 (61%) Frame = +3 Query: 39 IMTEDPNLEKMRFDLVPKVITEENFWRNYFYRLSLI 146 ++ E P+L K LVP ++ ++FW+ +F+ ++ Sbjct: 183 LLEEYPDLRKQMESLVPSEVSYDDFWKRFFWHKEVV 218 >SPCC1919.12c |||aminopeptidase |Schizosaccharomyces pombe|chr 3|||Manual Length = 843 Score = 25.0 bits (52), Expect = 7.7 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 252 ITPLVCTMHNSHILALYYNNNMI 320 I P V H ILAL+Y N+I Sbjct: 410 INPYVINSHTGLILALFYLTNLI 432 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,915,684 Number of Sequences: 5004 Number of extensions: 33254 Number of successful extensions: 65 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 238029836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -