BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d02f (564 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56826| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 8e-15 SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) 30 1.5 >SB_56826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 77.4 bits (182), Expect = 8e-15 Identities = 33/59 (55%), Positives = 47/59 (79%) Frame = +3 Query: 3 FDYDKMYPVAVAIMTEDPNLEKMRFDLVPKVITEENFWRNYFYRLSLICQANEADALAA 179 ++ + M+PVA+A + +D NLE+MRF LVPK ++EE FWRNYFYR+SLI Q+ + +LAA Sbjct: 113 YEGETMFPVALATLQKDENLEQMRFKLVPKKVSEERFWRNYFYRVSLIKQSTQLTSLAA 171 >SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) Length = 551 Score = 29.9 bits (64), Expect = 1.5 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -3 Query: 490 FLIINHYINIYRYMCVSANTMKVSDGIILSR 398 FL++++ IN Y Y VS+N+ D ++L R Sbjct: 411 FLLVSYGINAYWYRMVSSNSCSPGDPLVLER 441 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,785,095 Number of Sequences: 59808 Number of extensions: 239087 Number of successful extensions: 505 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 505 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1325051197 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -