BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d01r (744 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 25 2.5 AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease pr... 24 5.7 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 25.0 bits (52), Expect = 2.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 634 YGVNKPEAIARIKDLYEELQ 575 YG N P +ARI+ L+++ Q Sbjct: 518 YGTNMPALVARIRQLHQQGQ 537 >AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease protein. Length = 435 Score = 23.8 bits (49), Expect = 5.7 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = -1 Query: 672 GQLLPKNKSWKTITESINLKLSPGL-KISMKNFSYPIRTRSSKKLPTISLERRSNKSQGD 496 GQL N +T+ E + + K+ NF+ + R SK L LER+ ++G+ Sbjct: 32 GQLFNVNDVDQTLVEEDHGVAGVAIPKVHRLNFAERKQQRQSKHLDLNELERKRRATEGN 91 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 694,736 Number of Sequences: 2352 Number of extensions: 12072 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -