BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d01r (744 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81106-1|CAB03221.2| 352|Caenorhabditis elegans Hypothetical pr... 64 1e-10 >Z81106-1|CAB03221.2| 352|Caenorhabditis elegans Hypothetical protein R06C1.2 protein. Length = 352 Score = 63.7 bits (148), Expect = 1e-10 Identities = 35/86 (40%), Positives = 54/86 (62%), Gaps = 7/86 (8%) Frame = -3 Query: 742 VTEKYGTDIQDGKCTWLAVVALQR--ATPAQ--KQIMED---NYGVNKPEAIARIKDLYE 584 +T K GTDIQDGKCTWLAV ALQ+ TP + +++E+ ++G PE + +IK +Y+ Sbjct: 244 ITGKIGTDIQDGKCTWLAVRALQKMHKTPEKWGAKLIEEFKTSFGSVDPEKVEKIKRIYD 303 Query: 583 ELQLPHTYSVFEETTYDLLRTQIQQV 506 ELQL + FE+ ++ I ++ Sbjct: 304 ELQLKQEFRRFEKHFSGEIKKSISEI 329 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,157,591 Number of Sequences: 27780 Number of extensions: 281830 Number of successful extensions: 625 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 624 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1756472266 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -