BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c24f (552 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53440.1 68418.m06641 expressed protein 29 1.6 At5g44800.1 68418.m05492 chromodomain-helicase-DNA-binding famil... 29 2.7 At4g02300.1 68417.m00311 pectinesterase family protein contains ... 28 3.6 At4g37320.1 68417.m05285 cytochrome P450 family protein 28 4.8 At5g03990.1 68418.m00379 expressed protein predicted protein, Ar... 27 6.3 At2g18910.1 68415.m02206 hydroxyproline-rich glycoprotein family... 27 6.3 At5g14360.1 68418.m01678 ubiquitin family protein contains INTER... 27 8.3 >At5g53440.1 68418.m06641 expressed protein Length = 1181 Score = 29.5 bits (63), Expect = 1.6 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 3/89 (3%) Frame = +3 Query: 273 EHSGEESKINSNTATTILKSVDKDLLAGRKK--GSIK-EYFSPRNIVTKKKNSSKSIQVN 443 E S +E K ++TT+ S + RK+ S+ EY+ + K+ KS + Sbjct: 25 ETSLKEKKSKEESSTTVRVSKESGSGDKRKEYYDSVNGEYYEEYTSSSSKRRKGKSGESG 84 Query: 444 LDKWISENDLCLEVPSETYWKVVAEKRRK 530 D+W ++D E +T KV +EK RK Sbjct: 85 SDRWNGKDDDKGESSKKT--KVSSEKSRK 111 >At5g44800.1 68418.m05492 chromodomain-helicase-DNA-binding family protein / CHD family protein similar to chromatin remodeling factor CHD3 (PICKLE) [Arabidopsis thaliana] GI:6478518; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00628: PHD-finger, PF00385: 'chromo' (CHRromatin Organization MOdifier) Length = 2228 Score = 28.7 bits (61), Expect = 2.7 Identities = 16/55 (29%), Positives = 25/55 (45%) Frame = +3 Query: 270 SEHSGEESKINSNTATTILKSVDKDLLAGRKKGSIKEYFSPRNIVTKKKNSSKSI 434 S H+ ES N T+ + LAG GS + P N+ + + SS++I Sbjct: 2052 SSHNAVESSSQGNPQTSATPPLPPPSLAGETSGSSQPKLPPHNLNSTEPLSSEAI 2106 >At4g02300.1 68417.m00311 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 532 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/33 (42%), Positives = 23/33 (69%), Gaps = 3/33 (9%) Frame = +3 Query: 399 IVTKKKNSSKSIQVNLD--KWISEND-LCLEVP 488 ++++KK S KS +V+++ W+SEND LE P Sbjct: 182 VISRKKPSPKSSEVDVEYPSWLSENDQRLLEAP 214 >At4g37320.1 68417.m05285 cytochrome P450 family protein Length = 495 Score = 27.9 bits (59), Expect = 4.8 Identities = 12/49 (24%), Positives = 26/49 (53%) Frame = +3 Query: 306 NTATTILKSVDKDLLAGRKKGSIKEYFSPRNIVTKKKNSSKSIQVNLDK 452 N +++ + +++AG G++ +Y N VT +N +K + LD+ Sbjct: 203 NDEAKLVRELIAEIMAGAGSGNLADYLPSINWVTNFENQTKILGNRLDR 251 >At5g03990.1 68418.m00379 expressed protein predicted protein, Arabidopsis thaliana Length = 302 Score = 27.5 bits (58), Expect = 6.3 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = +3 Query: 384 FSPRNIVTKKKNSSK----SIQVNLDKWISENDLCLEVPSETYWKVVAEKR 524 +S + T ++SSK + ++++ W E D C + S +WKVV KR Sbjct: 17 YSRQRGTTMTQSSSKPPLANCKISVPAW--EKDFCAVIGSVPWWKVVEAKR 65 >At2g18910.1 68415.m02206 hydroxyproline-rich glycoprotein family protein Length = 131 Score = 27.5 bits (58), Expect = 6.3 Identities = 14/56 (25%), Positives = 29/56 (51%) Frame = +3 Query: 339 KDLLAGRKKGSIKEYFSPRNIVTKKKNSSKSIQVNLDKWISENDLCLEVPSETYWK 506 K + + + GS+ +F +N VTK +N+ S+ +L +W N + + Y++ Sbjct: 57 KSVASSDQDGSVLGFF--KNAVTKVQNAHSSVDDHLVRWFGLNQSKYQWALDEYYE 110 >At5g14360.1 68418.m01678 ubiquitin family protein contains INTERPRO:IPR000626 ubiquitin domain Length = 163 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +1 Query: 451 NGSQRTTCALKFLLKPIGKLLQKRE 525 N S + C +K+ L+P G L+QKR+ Sbjct: 38 NNSSCSNCEIKWELRPGGMLVQKRQ 62 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,916,612 Number of Sequences: 28952 Number of extensions: 157797 Number of successful extensions: 476 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 468 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 476 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1043173136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -