BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c22f (467 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein ... 199 3e-53 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 24 2.3 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 24 2.3 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 23 4.0 AF026494-1|AAB81852.1| 113|Anopheles gambiae chitinase protein. 22 9.3 >AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein S17 protein. Length = 131 Score = 199 bits (486), Expect = 3e-53 Identities = 98/117 (83%), Positives = 105/117 (89%) Frame = +1 Query: 106 IEKYYTRLTLDFDTNKRICEEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGISIKLQEE 285 IEKYYTRLT+DFDTNKRI EE+AIIPTKPLRNKIAGF THLM+RLRHSQVRGISIKLQEE Sbjct: 17 IEKYYTRLTMDFDTNKRIVEEVAIIPTKPLRNKIAGFVTHLMKRLRHSQVRGISIKLQEE 76 Query: 286 ERERRDNYVPEVSALEHDIIEVDPDTKDMLKMLDFNNINGLQLTQPATQGGYGGRRN 456 ERERRDNYVP+VSALE DIIEVDP+TK+MLK LDFNNI +QLT P T GY RRN Sbjct: 77 ERERRDNYVPDVSALEQDIIEVDPETKEMLKHLDFNNI-VVQLTNP-TAPGYSNRRN 131 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 24.2 bits (50), Expect = 2.3 Identities = 13/47 (27%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = +1 Query: 259 GISIKLQEEERERRDNYVPEVSALE-HDIIEVDPDTKDMLKMLDFNN 396 G + +L+EEE + + + PE+ E + ++V + K+M+ + D +N Sbjct: 87 GTTCELEEEEVDLQAKHAPEMDGSELMEAVDVAAELKNMV-LQDISN 132 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 24.2 bits (50), Expect = 2.3 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +2 Query: 236 VSDTRKCEESLSNFRKRSVRGVTTMSQKCLLSNMTS 343 +++TR C E++S F+ R T+ +K + + TS Sbjct: 356 INETRVCGENISTFQLEERRRRRTVIEKLNIEDGTS 391 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 23.4 bits (48), Expect = 4.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 337 DIIEVDPDTKDMLKMLDFNNINGL 408 DI +VDPD L + NNI G+ Sbjct: 636 DIEDVDPDLHRSLTWILENNITGI 659 >AF026494-1|AAB81852.1| 113|Anopheles gambiae chitinase protein. Length = 113 Score = 22.2 bits (45), Expect = 9.3 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -2 Query: 67 HDPWLKLYSAAFDRIKEKRKK 5 HD W + + ++R+ E +KK Sbjct: 41 HDSWADIDNRFYERVVELKKK 61 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 441,296 Number of Sequences: 2352 Number of extensions: 8234 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 40820256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -