BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c21r (764 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 30 0.021 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 23 3.1 DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 22 5.4 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 22 7.2 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 21 9.5 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 30.3 bits (65), Expect = 0.021 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = -2 Query: 622 YDDDSTIYVASND-GIYVYKTGDKSFKKYGTFKADVISLTKMNGSDLFYAVTNDNKAY 452 ++ D ++V SN +Y+Y + D S Y FKA+V K D Y V + Y Sbjct: 491 HEYDQNVWVLSNKLAMYLYGSIDSSKINYRIFKANVKEAVKDTXCDPNYVVPDSEHGY 548 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = +2 Query: 302 KIDFFHSLFHFKYFIIQSDIVQYIEVIKHNLFDGFQF 412 KI +FH++ F + ++++Q + K N + F F Sbjct: 253 KILYFHAMSSIAEFSVSTEVLQDHTLEKSNDYYAFHF 289 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 22.2 bits (45), Expect = 5.4 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 439 NGNKYVLDDKLKAVKQVMFDNFNVL 365 NGN V D+ +++ + M FNV+ Sbjct: 49 NGNVNVEDENVQSYVECMMKKFNVV 73 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.8 bits (44), Expect = 7.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -2 Query: 397 KQVMFDNFNVLHYVTLDNEVF 335 ++++FD +V +T DN F Sbjct: 167 EEILFDTVHVTFKLTFDNRAF 187 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 21.4 bits (43), Expect = 9.5 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 357 T*CNTLKLSNITCLTAFNLSSKTYLLP 437 T C T S T F SSK Y P Sbjct: 199 TCCTTXWWSXXTVAXTFKYSSKPYXFP 225 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,261 Number of Sequences: 438 Number of extensions: 4037 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -