BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c18r (648 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39807| Best HMM Match : Ribosomal_S8e (HMM E-Value=0) 287 5e-78 SB_22712| Best HMM Match : Ribosomal_S8e (HMM E-Value=0.068) 56 3e-08 SB_8638| Best HMM Match : PP2C (HMM E-Value=6.5e-32) 33 0.26 SB_17079| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_810| Best HMM Match : TAF4 (HMM E-Value=4.7e-31) 30 1.9 SB_37792| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_11| Best HMM Match : E6 (HMM E-Value=2.2) 29 3.3 SB_26394| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.88) 29 4.3 SB_4689| Best HMM Match : Dicty_CTDC (HMM E-Value=5.8) 29 4.3 SB_1748| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_38738| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56915| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_48089| Best HMM Match : DUF638 (HMM E-Value=3.3) 27 9.9 >SB_39807| Best HMM Match : Ribosomal_S8e (HMM E-Value=0) Length = 192 Score = 287 bits (704), Expect = 5e-78 Identities = 133/189 (70%), Positives = 156/189 (82%) Frame = -1 Query: 567 PIRKKRKYELGRPAANTRLGPQRIHSVRSRGGNTKYRALRLDTGNFSWGSECSTRKTRII 388 P+R KRK+ELGRP ANT++G +RIH VR+RGGN K+RA RLDT NFSWGSE TRK RII Sbjct: 4 PLRHKRKFELGRPPANTKIGTKRIHEVRTRGGNRKFRAFRLDTENFSWGSESCTRKARII 63 Query: 387 DVVYNASNNELVRTKTLVKNAIVVVDATPFRQWYESHYTLPLGRKKGAKLTEAEEAIINK 208 DVVYNASNNELVRTKTLVKN IV VD+TPFRQWYE+HY +P+GRKK + TE E+ I+NK Sbjct: 64 DVVYNASNNELVRTKTLVKNCIVQVDSTPFRQWYEAHYAIPIGRKKTKQPTEEEQEILNK 123 Query: 207 KRSQKTARKYLARQRLAKVEGALEEQFHTGRLLACVASRPGQCGRADGYILEGKELEFYL 28 KRS RK AR+ AKV +EEQF TGRL ACV+SRPGQ GR DGYILEGKELEFY+ Sbjct: 124 KRSNHCTRKLEARKANAKVAPGMEEQFVTGRLYACVSSRPGQSGRCDGYILEGKELEFYI 183 Query: 27 RKIKSKRAK 1 +K+K+++AK Sbjct: 184 KKLKARKAK 192 >SB_22712| Best HMM Match : Ribosomal_S8e (HMM E-Value=0.068) Length = 147 Score = 55.6 bits (128), Expect = 3e-08 Identities = 24/77 (31%), Positives = 47/77 (61%) Frame = -1 Query: 507 PQRIHSVRSRGGNTKYRALRLDTGNFSWGSECSTRKTRIIDVVYNASNNELVRTKTLVKN 328 P++I ++ GG+TK +ALR++ G ++ S+ + I+ V+++ +N E + +VK Sbjct: 37 PEKIKERKAYGGHTKIKALRVNKGVYTLKSQGVEVEAPILSVMHSFANKEHIERNVIVKG 96 Query: 327 AIVVVDATPFRQWYESH 277 +IV VD PF W++ + Sbjct: 97 SIVQVDNKPFEDWFQEY 113 >SB_8638| Best HMM Match : PP2C (HMM E-Value=6.5e-32) Length = 905 Score = 32.7 bits (71), Expect = 0.26 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = -1 Query: 207 KRSQKTARKYLARQRLAKVEGALEEQFHTGRLLACVASRPGQCGRADGYILEGK 46 ++S+K K + +L +EG E H G LL S C R GY ++G+ Sbjct: 133 EKSEKYTEKKIRSDKLTWIEGNEEGASHIGDLLLKYDSLVSSCSRRIGYDIQGR 186 >SB_17079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2537 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -1 Query: 591 RATGGKRAPIRKKRKYELGRPAANTRLGP 505 R GG R P+++ +E +P+ N R GP Sbjct: 769 RRGGGSRVPVKRSSSFENRKPSPNRRRGP 797 >SB_810| Best HMM Match : TAF4 (HMM E-Value=4.7e-31) Length = 883 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = -1 Query: 252 KGAKLTEAEEAIINKKRSQKTARKYLARQRLAKVEGALEEQFHTGR 115 + AKL + EE II K+ + TA + ++ K++ ALE +G+ Sbjct: 701 RAAKLQQEEEEIIRKREANNTALAAIGPRKKRKLDEALEATRPSGQ 746 >SB_37792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = -1 Query: 408 TRKTRIIDVVYNASNNELVRTKTLVKNAIVVVDATPFR 295 T++ +I D++ N N VR +TL+ NA +++D F+ Sbjct: 18 TKRKKIADILSNEIRN--VRERTLILNAALIIDICVFK 53 >SB_11| Best HMM Match : E6 (HMM E-Value=2.2) Length = 485 Score = 29.1 bits (62), Expect = 3.3 Identities = 26/93 (27%), Positives = 38/93 (40%), Gaps = 9/93 (9%) Frame = -1 Query: 300 FRQWYESHYTLPLGRKKGAKLTEAEEAIINKKRSQKTARKYLARQRLA---KVEGALE-- 136 F W + L + +G + E +E + N +KT + YL K++GA E Sbjct: 174 FEAWKDIRKVLLNYKNEGTGIVEVDEGVTNN--IEKTLKLYLISPNHEIDQKLKGAPEKD 231 Query: 135 ----EQFHTGRLLACVASRPGQCGRADGYILEG 49 E FH L CV + + DGY L G Sbjct: 232 IYFYETFHFLGGLQCVPLQENEISITDGYALMG 264 >SB_26394| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.88) Length = 842 Score = 28.7 bits (61), Expect = 4.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 133 AIPHRAFAGLRGESPRSVW 77 A PH A +G+R SPR +W Sbjct: 108 ACPHHAVSGVRVSSPRGIW 126 Score = 28.3 bits (60), Expect = 5.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 133 AIPHRAFAGLRGESPRSVW 77 A PH A +G+R PRS+W Sbjct: 139 AYPHHAVSGVRVSPPRSIW 157 Score = 28.3 bits (60), Expect = 5.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 133 AIPHRAFAGLRGESPRSVW 77 A PH A +G+R PRS+W Sbjct: 201 ACPHHAVSGVRVSPPRSIW 219 Score = 28.3 bits (60), Expect = 5.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 133 AIPHRAFAGLRGESPRSVW 77 A PH A +G+R PRS+W Sbjct: 232 ACPHHAVSGVRVSPPRSIW 250 >SB_4689| Best HMM Match : Dicty_CTDC (HMM E-Value=5.8) Length = 530 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/47 (23%), Positives = 24/47 (51%) Frame = +2 Query: 278 CDSYHCLNGVASTTTIAFLTRVFVRTNSLLDALYTTSMIRVLRVEHS 418 CD+ HC + T+T+ + +V + + ++ ++ V R +HS Sbjct: 448 CDNDHCSQELCLTSTVDQIQQVLNNCDKIKTQVHVEGLVEVWRKDHS 494 >SB_1748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 683 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -1 Query: 633 PTKMGISRDHWHKRRATGGKRAPIRKKRK-YELGRPAANTRLGPQRIHSV 487 P +S D W K++ K+ I+KKR+ + A LG QR+ + Sbjct: 383 PKMQSLSYDEWLKQKREQDKKQAIKKKREIIDSHLDAVVAELGKQRVERI 432 >SB_38738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -1 Query: 210 KKRSQKTARKYLARQRLAKVEGALEE 133 K+R QK + Y RQR ++ +LEE Sbjct: 15 KRRKQKATKSYAERQRRTRINKSLEE 40 >SB_56915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 720 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -3 Query: 409 NSQNPYH*CCV*CI*Q*-IGAYKDPCQECNCCSRCNSI 299 +S YH C C+ I Y DP EC CS+C+ + Sbjct: 192 DSLEVYHECFGGCVGTLEIELYTDPYAECVTCSQCDGV 229 >SB_48089| Best HMM Match : DUF638 (HMM E-Value=3.3) Length = 811 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = -2 Query: 530 PLQTPGSALSESTPFVHVVEILSTVRCVWTPVTSLGDRNVQL 405 P ++P L +TP VHVV + R V +TS+ +N+++ Sbjct: 632 PRRSPLLQLLSNTPDVHVVVVELFQRHVHAVLTSMAKKNIKI 673 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,393,864 Number of Sequences: 59808 Number of extensions: 431662 Number of successful extensions: 1207 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1204 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -