BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c16r (750 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0970 - 33478044-33478399,33478593-33478692,33479181-33480047 32 0.56 01_06_0496 - 29795490-29796638,29796811-29796870,29798168-297983... 29 3.0 01_01_0908 + 7158172-7158356,7159436-7159866,7159953-7161061,716... 28 9.1 >01_06_0970 - 33478044-33478399,33478593-33478692,33479181-33480047 Length = 440 Score = 31.9 bits (69), Expect = 0.56 Identities = 22/79 (27%), Positives = 33/79 (41%), Gaps = 1/79 (1%) Frame = +2 Query: 323 TFSTSRQHESFRHVTELFRHIKRYFSFV-EHLHNFSHWHGVFFKYDKFIRIADNLVLTSG 499 +FS R R ++ + + F+ +F HW K +KF R DNL+L Sbjct: 21 SFSRIRAIVRMRRLSRRWMRVIECLQFICLDYRDFKHW-----KVEKFARFVDNLLLIRS 75 Query: 500 EFSCEPVQLEEFHPVVL*C 556 + QL FH + L C Sbjct: 76 KVDLHTFQLYWFHYLPLNC 94 >01_06_0496 - 29795490-29796638,29796811-29796870,29798168-29798371, 29798739-29798984,29799375-29799464 Length = 582 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -3 Query: 523 LDWFTTKLTAGQNKIIRNSNEFVIFKEDSVPMTEIMKM 410 +D F T +T KI RNS +F DSVP +++ ++ Sbjct: 278 VDSFQTNMTVEPEKIKRNSRKFSSSAADSVPDSQLSEL 315 >01_01_0908 + 7158172-7158356,7159436-7159866,7159953-7161061, 7161372-7162820 Length = 1057 Score = 27.9 bits (59), Expect = 9.1 Identities = 8/24 (33%), Positives = 19/24 (79%) Frame = -3 Query: 475 RNSNEFVIFKEDSVPMTEIMKMLD 404 RN+ + V++ ++S+P T +++M+D Sbjct: 839 RNAGQVVLYPKESMPATHLLRMMD 862 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,436,401 Number of Sequences: 37544 Number of extensions: 420382 Number of successful extensions: 975 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 949 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 974 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -