BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c16r (750 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15319| Best HMM Match : Transposase_9 (HMM E-Value=3.2) 32 0.57 SB_49488| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_36107| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) 30 2.3 SB_24180| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_13174| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_49747| Best HMM Match : RVT_1 (HMM E-Value=2.1e-36) 30 2.3 SB_46950| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) 30 2.3 SB_45147| Best HMM Match : zf-CCHC (HMM E-Value=0.0051) 30 2.3 SB_32803| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_23788| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38) 30 2.3 SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) 30 2.3 SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14) 30 2.3 SB_44616| Best HMM Match : rve (HMM E-Value=0.012) 29 3.0 SB_19217| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_24050| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_20046| Best HMM Match : UPAR_LY6 (HMM E-Value=3.2) 29 4.0 SB_47225| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_56854| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_47005| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_24712| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_20652| Best HMM Match : OmpH (HMM E-Value=1.9) 28 9.3 SB_12593| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_50077| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_2018| Best HMM Match : AIRC (HMM E-Value=5.1) 28 9.3 >SB_15319| Best HMM Match : Transposase_9 (HMM E-Value=3.2) Length = 782 Score = 31.9 bits (69), Expect = 0.57 Identities = 24/94 (25%), Positives = 40/94 (42%) Frame = -3 Query: 352 RLMLPRGTEGGFPFQLFVFVYPFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPN 173 R L + G +P QL + V PF KG P++ + + F + R N Sbjct: 333 RRWLSEPSYGYWPQQLNLAVCPFTQKGN---PYKKAAFERLCIEFGMSRKPDFRWKGGRN 389 Query: 172 MYFKDIFIYHEGERFPYKFNIPSYDTQSNVVPKN 71 D+F+++ GE + I YDT ++ P + Sbjct: 390 HGLGDVFVFYPGEGYRNVHVIRGYDTAADEYPSH 423 >SB_49488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1228 Score = 30.7 bits (66), Expect = 1.3 Identities = 20/97 (20%), Positives = 42/97 (43%), Gaps = 1/97 (1%) Frame = -3 Query: 748 DASNSVYFSKEEIKNNHVHDVKVRQPRLNHSPFNVNIEVDSNVASDAVVKIFLAPKYDDN 569 D +SV + + ++++ ++ + I V V S + I Y + Sbjct: 275 DTGSSVSIIPRNVYESTCKHLELKPAKVKLRTYGSEIIVPMGVVSARTLVITTNAMYVVD 334 Query: 568 GIPLTLED-NWMKFFELDWFTTKLTAGQNKIIRNSNE 461 G + L +W++ F+L+W + KL G+N + + E Sbjct: 335 GPRVALFGRSWLRLFKLEWPSIKLVQGKNTALSDLTE 371 Score = 30.7 bits (66), Expect = 1.3 Identities = 20/97 (20%), Positives = 42/97 (43%), Gaps = 1/97 (1%) Frame = -3 Query: 748 DASNSVYFSKEEIKNNHVHDVKVRQPRLNHSPFNVNIEVDSNVASDAVVKIFLAPKYDDN 569 D +SV + + ++++ ++ + I V V S + I Y + Sbjct: 758 DTGSSVSIIPRNVYESTCKHLELKPAKVKLRTYGSEIIVPMGVVSARTLVITTNAMYVVD 817 Query: 568 GIPLTLED-NWMKFFELDWFTTKLTAGQNKIIRNSNE 461 G + L +W++ F+L+W + KL G+N + + E Sbjct: 818 GPRVALFGRSWLRLFKLEWPSIKLVQGKNTALSDLTE 854 >SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 544 NWMKFFELDWFTTKLTAGQNKIIRNSNE 461 +W++ F+LDW + KL G+N + + E Sbjct: 219 SWLRLFKLDWPSMKLVEGKNTALSDLTE 246 >SB_36107| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) Length = 425 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 544 NWMKFFELDWFTTKLTAGQNKIIRNSNE 461 +W++ F+LDW + KL G+N + + E Sbjct: 377 SWLRLFKLDWPSIKLVQGKNTALSDLTE 404 >SB_24180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 544 NWMKFFELDWFTTKLTAGQNKIIRNSNE 461 +W++ F+LDW + KL G+N + + E Sbjct: 76 SWLRLFKLDWPSIKLVQGKNTALSDLTE 103 >SB_13174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1108 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/73 (26%), Positives = 31/73 (42%) Frame = -3 Query: 289 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 110 PF KG P++ + + F L R N D+F+++ GE + I Sbjct: 155 PFTQKGN---PYKKAAFERLCIEFGLPRKPDFRWKGGRNHGLDDVFVFYPGEGYRNMHVI 211 Query: 109 PSYDTQSNVVPKN 71 P YDT ++ P + Sbjct: 212 PGYDTAADEYPSH 224 >SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2309 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 544 NWMKFFELDWFTTKLTAGQNKIIRNSNE 461 +W++ F+LDW + KL G+N + + E Sbjct: 293 SWLRLFKLDWPSIKLVQGKNTALSDLTE 320 >SB_49747| Best HMM Match : RVT_1 (HMM E-Value=2.1e-36) Length = 877 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 544 NWMKFFELDWFTTKLTAGQNKIIRNSNE 461 +W++ F+LDW + KL G+N + + E Sbjct: 76 SWLRLFKLDWPSIKLVQGKNTALSDLTE 103 >SB_46950| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) Length = 797 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 544 NWMKFFELDWFTTKLTAGQNKIIRNSNE 461 +W++ F+LDW + KL G+N + + E Sbjct: 287 SWLRLFKLDWPSIKLVQGKNTALSDLTE 314 >SB_45147| Best HMM Match : zf-CCHC (HMM E-Value=0.0051) Length = 522 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 544 NWMKFFELDWFTTKLTAGQNKIIRNSNE 461 +W++ F+LDW + KL G+N + + E Sbjct: 164 SWLRLFKLDWPSIKLVQGKNTALSDLTE 191 >SB_32803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 544 NWMKFFELDWFTTKLTAGQNKIIRNSNE 461 +W++ F+LDW + KL G+N + + E Sbjct: 15 SWLRLFKLDWPSIKLVQGKNTALSDLTE 42 >SB_23788| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38) Length = 1122 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 544 NWMKFFELDWFTTKLTAGQNKIIRNSNE 461 +W++ F+LDW + KL G+N + + E Sbjct: 399 SWLRLFKLDWPSIKLVQGKNTALSDLTE 426 >SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1696 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 544 NWMKFFELDWFTTKLTAGQNKIIRNSNE 461 +W++ F+LDW + KL G+N + + E Sbjct: 467 SWLRLFKLDWPSIKLVQGKNTALSDLTE 494 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 544 NWMKFFELDWFTTKLTAGQNKIIRNSNE 461 +W++ F+LDW + KL G+N + + E Sbjct: 1117 SWLRLFKLDWPSIKLVQGKNTALSDLTE 1144 >SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) Length = 837 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 544 NWMKFFELDWFTTKLTAGQNKIIRNSNE 461 +W++ F+LDW + KL G+N + + E Sbjct: 143 SWLRLFKLDWPSMKLVEGKNTALSDLTE 170 >SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14) Length = 1217 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 544 NWMKFFELDWFTTKLTAGQNKIIRNSNE 461 +W++ F+LDW + KL G+N + + E Sbjct: 176 SWLRLFKLDWPSIKLVQGKNTALSDLTE 203 >SB_44616| Best HMM Match : rve (HMM E-Value=0.012) Length = 1189 Score = 29.5 bits (63), Expect = 3.0 Identities = 24/86 (27%), Positives = 39/86 (45%), Gaps = 1/86 (1%) Frame = -3 Query: 325 GGFPFQLFVFVYPFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFK-DIFI 149 G +P QL V PF KG P++ + + F L R D +K + D+F+ Sbjct: 376 GYWPQQLNFAVCPFTQKGN---PYKKAAFERLCIEFSLPRKP-DFRWKGGRNHGPGDVFV 431 Query: 148 YHEGERFPYKFNIPSYDTQSNVVPKN 71 ++ GE + I YDT ++ P + Sbjct: 432 FYPGEGYRNVHVILGYDTAADEYPSH 457 >SB_19217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 29.5 bits (63), Expect = 3.0 Identities = 24/85 (28%), Positives = 36/85 (42%) Frame = -3 Query: 325 GGFPFQLFVFVYPFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIY 146 G +P QL V PF KG P++ V + + F L R N D+F++ Sbjct: 238 GYWPQQLNFAVCPFTQKGN---PYKKAVFERLCIEFGLPRNPDFRWKGGRNHGLGDVFVF 294 Query: 145 HEGERFPYKFNIPSYDTQSNVVPKN 71 + GE I YDT ++ P + Sbjct: 295 YPGEGNRNVHVIRGYDTAADEYPSH 319 >SB_24050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1092 Score = 29.1 bits (62), Expect = 4.0 Identities = 20/73 (27%), Positives = 31/73 (42%) Frame = -3 Query: 289 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 110 PF KGK P++ + + F L R L N D+F+++ GE + I Sbjct: 203 PFTQKGK---PYKKAAFERLCIEFGLPRKPDFRLKGGRNHGLGDVFVFYPGEGYRNVHVI 259 Query: 109 PSYDTQSNVVPKN 71 YDT + P + Sbjct: 260 RGYDTAMDEYPSH 272 >SB_20046| Best HMM Match : UPAR_LY6 (HMM E-Value=3.2) Length = 419 Score = 29.1 bits (62), Expect = 4.0 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 544 NWMKFFELDWFTTKLTAGQNKIIRNSNE 461 +W++ F+LDW + KL G+N + + E Sbjct: 349 SWLRLFKLDWPSIKLVQGKNIALSDLTE 376 >SB_47225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/73 (26%), Positives = 31/73 (42%) Frame = -3 Query: 289 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 110 PF KG P++ + + F L R N D+F+++ GER+ I Sbjct: 186 PFTQKGN---PYKKAAFERLCIEFGLPRKPDFRWKGGRNHGLGDVFVFYPGERYRNVHVI 242 Query: 109 PSYDTQSNVVPKN 71 YDT ++ P + Sbjct: 243 RGYDTAADEYPSH 255 >SB_56854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -1 Query: 210 IAPLLMHYSRFLTCISRIFSFTTRVNGSLTNSIFLRMTHS 91 I PL+ L C+S + T ++GSL++ + ++TH+ Sbjct: 45 ILPLVPRPKELLECVSNMRLLTWLLHGSLSHMVHSKITHA 84 >SB_47005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 289 Score = 27.9 bits (59), Expect = 9.3 Identities = 19/73 (26%), Positives = 31/73 (42%) Frame = -3 Query: 289 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 110 PF KG P++ + + F L R V N D+F+++ GE + I Sbjct: 177 PFTQKGN---PYKKAAFERLCIEFGLPRKQVFRWKGGRNHGLGDVFVFYPGEGYCNVHVI 233 Query: 109 PSYDTQSNVVPKN 71 YDT ++ P + Sbjct: 234 RGYDTAADEYPSH 246 >SB_24712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 27.9 bits (59), Expect = 9.3 Identities = 19/73 (26%), Positives = 32/73 (43%) Frame = -3 Query: 289 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 110 PF KG P++ + + F L R + N D+F+++ GE + I Sbjct: 179 PFTQKGN---PYKKAAFERLCIEFGLPRKLDFRWKGGRNHGLGDVFVFYPGEGYRNVHVI 235 Query: 109 PSYDTQSNVVPKN 71 SYDT ++ P + Sbjct: 236 CSYDTAADEYPSH 248 >SB_20652| Best HMM Match : OmpH (HMM E-Value=1.9) Length = 842 Score = 27.9 bits (59), Expect = 9.3 Identities = 22/76 (28%), Positives = 33/76 (43%), Gaps = 3/76 (3%) Frame = -3 Query: 289 PFDNKGKDL--APFESFVLD-NKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYK 119 PF KG A FE ++ P G P++R N D+F+++ GER Sbjct: 132 PFTQKGNPYKKAAFERLCIEFGLPPGLPMERR--------RNHGLGDVFVFYPGERCRNV 183 Query: 118 FNIPSYDTQSNVVPKN 71 I YDT ++ P + Sbjct: 184 HVIRGYDTAADKYPSH 199 >SB_12593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -3 Query: 160 DIFIYHEGERFPYKFNIPSYDTQSNVVPKN 71 D+F+++ GE + IP YDT ++ P + Sbjct: 259 DVFVFYPGEGYRNVHVIPGYDTAADEYPSH 288 >SB_50077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 907 Score = 27.9 bits (59), Expect = 9.3 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 3/76 (3%) Frame = -3 Query: 289 PFDNKGKDL--APFESFVLD-NKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYK 119 PF KG A FE ++ P G P++R L D+F+++ GE + Sbjct: 128 PFTQKGNPYKKAAFERLCIEFGLPPGLPMERRAEHGL--------GDVFVFYPGEGYRNV 179 Query: 118 FNIPSYDTQSNVVPKN 71 I YDT ++ P + Sbjct: 180 HVIRGYDTAADEYPSH 195 >SB_2018| Best HMM Match : AIRC (HMM E-Value=5.1) Length = 298 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -3 Query: 160 DIFIYHEGERFPYKFNIPSYDTQSNVVPKN 71 D+F+++ GE + IP YDT ++ P + Sbjct: 253 DVFVFYPGEGYRNVHVIPGYDTAADEYPSH 282 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,831,557 Number of Sequences: 59808 Number of extensions: 503042 Number of successful extensions: 1441 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 1297 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1439 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -