BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c12r (770 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33376| Best HMM Match : Peptidase_C13 (HMM E-Value=0.00035) 30 1.8 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 29 3.1 SB_46130| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_50367| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 >SB_33376| Best HMM Match : Peptidase_C13 (HMM E-Value=0.00035) Length = 1008 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -2 Query: 493 DGLALTLSNDVHGNDGRLAFGDGKDKTSPKVSWKFIALWENNKVY 359 D L L + HG DG L F D ++ TS +++ F +W+ + + Sbjct: 127 DCLLYILFSPGHGGDGFLKFQDAEEVTSVELADAFEQMWQKQRYH 171 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 29.5 bits (63), Expect = 3.1 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 1/70 (1%) Frame = -3 Query: 720 PITTVRLKRASIYTR-RRRAKSSQM**TN*YETTR*TAWSTPINFGSRAPRTSSVIVSQL 544 P T + R+S T RRR +++Q+ T Y+ T T+ + SR T ++ VS Sbjct: 3951 PTTGISESRSSSVTSIRRRFENNQLEET--YKRTETTSLVMDVQERSRESTTLAIDVSPR 4008 Query: 543 SSDLSSPKTP 514 + ++SP+TP Sbjct: 4009 APSVTSPRTP 4018 >SB_46130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 407 Score = 28.7 bits (61), Expect = 5.5 Identities = 18/66 (27%), Positives = 33/66 (50%) Frame = +2 Query: 425 TVAEGKSAIVAVNIITQRQSETVALVHKLNGVFGEDKSELNWETITDDVLGALEPKLIGV 604 TVA+ ++ I + + ++V + G D SE ++ T +VL ALE + + + Sbjct: 71 TVAKTGMILLCGEITSNAVVDYQSVVRQCIKDIGYDDSEKGFDYKTCNVLVALEQQSVDI 130 Query: 605 LHAVHL 622 H VH+ Sbjct: 131 AHGVHV 136 >SB_50367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1498 Score = 27.9 bits (59), Expect = 9.6 Identities = 23/97 (23%), Positives = 43/97 (44%) Frame = -2 Query: 754 LEEQLYNSIVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLWLQGS 575 L L N I A +A + L++E K ++++NVV + + + + A++ W Q Sbjct: 810 LNRLLRNEISNAQGPNAAGQKNFLFQEVK-DILSNVVQRNMVRESLQAKKDAFESWRQVI 868 Query: 574 KDIVRDCFPVEFRLIFAENAIKLMYKRDGLALTLSND 464 + + C P + L + A+ L +D L D Sbjct: 869 EVALATC-PGDILLQDVKQAVILETLQDLLMKIAQED 904 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,148,799 Number of Sequences: 59808 Number of extensions: 462896 Number of successful extensions: 4685 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4685 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -