BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c12f (621 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g49400.1 68416.m05400 transducin family protein / WD-40 repea... 34 0.066 At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein b... 31 0.81 At5g63450.1 68418.m07965 cytochrome P450, putative 30 1.1 At3g48520.1 68416.m05296 cytochrome P450 family protein similar ... 30 1.4 At4g39510.1 68417.m05587 cytochrome P450 family protein contains... 29 1.9 At5g64820.1 68418.m08155 hypothetical protein 29 3.3 At5g13010.1 68418.m01491 RNA helicase, putative similar to DEAH-... 29 3.3 At3g30550.1 68416.m03866 hypothetical protein includes At2g05890... 29 3.3 At1g16280.1 68414.m01949 DEAD/DEAH box helicase, putative simila... 29 3.3 At5g03800.1 68418.m00347 exostosin family protein / pentatricope... 28 4.3 At4g00730.1 68417.m00099 anthocyaninless2 (ANL2) nearly identica... 28 4.3 At5g16590.1 68418.m01942 leucine-rich repeat transmembrane prote... 28 5.7 At2g04620.1 68415.m00470 cation efflux family protein potential ... 28 5.7 At1g06550.1 68414.m00694 enoyl-CoA hydratase/isomerase family pr... 28 5.7 At5g07400.1 68418.m00847 forkhead-associated domain-containing p... 27 7.6 At4g28590.1 68417.m04089 expressed protein 27 7.6 >At3g49400.1 68416.m05400 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); low similarity (47%) to Agamous-like MADS box protein AGL5 (SP:P29385) {Arabidopsis thaliana} Length = 892 Score = 34.3 bits (75), Expect = 0.066 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 8/76 (10%) Frame = -3 Query: 499 LPQSNELPADFRACFVLTVAEGKSAIVAV--------NIITQRQSETVALVHKLNGVFGE 344 L + +LP DF +C + ++ G A+ V N + Q +S+ A+ NG Sbjct: 482 LSSTTDLPDDFLSCLGVALSPGNLAVALVRNFNVELLNPMYQARSQKAAVEFLWNGAQQS 541 Query: 343 DKSELNWETITDDVLG 296 +SE + ET+T+ +LG Sbjct: 542 GESEDSTETVTEAILG 557 >At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein binding region-containing protein similar to U4/U6 snRNP-associated 61 kDa protein [Homo sapiens] GI:18249847; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 485 Score = 30.7 bits (66), Expect = 0.81 Identities = 17/60 (28%), Positives = 28/60 (46%) Frame = +2 Query: 47 PVIVILCLFVASLYAADSDVPNDILEEQLYNSIVVADYDSAVEKSKHLYEEKKSEVITNV 226 P +I+ + V +L S +P D+L++ L D DSA +K E K + N+ Sbjct: 161 PSAIIMVVSVTALTTKGSALPEDVLQKVLEACDRALDLDSARKKVLEFVESKMGSIAPNL 220 >At5g63450.1 68418.m07965 cytochrome P450, putative Length = 510 Score = 30.3 bits (65), Expect = 1.1 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +2 Query: 446 GKDKTSPKVSWKFIALWENNKVYFKILNTERNQYLVLGVG 565 G+D TS ++W F L +N+ V KIL+ RN+ LG+G Sbjct: 306 GRDTTSAAMTWLFWLLSQNDDVETKILDELRNKG-SLGLG 344 >At3g48520.1 68416.m05296 cytochrome P450 family protein similar to Cytochrome P450 94A1 (P450-dependent fatty acid omega-hydroxylase) (SP:O81117) {Vicia sativa}; contains Pfam profile: PF00067 cytochrome P450 Length = 506 Score = 29.9 bits (64), Expect = 1.4 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = +2 Query: 446 GKDKTSPKVSWKFIALWENNKVYFKILNTERNQYLVLGVG 565 G+D TS ++W F L EN+ V KIL E + + LG+G Sbjct: 304 GRDTTSAAMTWLFWLLTENDDVERKILE-EVDPLVSLGLG 342 >At4g39510.1 68417.m05587 cytochrome P450 family protein contains Pfam PF00067: Cytochrome P450; similar to Cytochrome P450 86A2 (SP:O23066) [Arabidopsis thaliana] Length = 508 Score = 29.5 bits (63), Expect = 1.9 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +2 Query: 392 LTLSNDVHGNDGRLAFG-DGKDKTSPKVSWKFIALWENNKVYFKI 523 L S+D D LAF G+D TS +SW F L EN +V KI Sbjct: 293 LNPSDDKFLRDTILAFNLAGRDTTSSALSWFFWLLSENPQVVTKI 337 >At5g64820.1 68418.m08155 hypothetical protein Length = 145 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = -3 Query: 460 CFVLTVAEGKSAIVAVNIITQRQSETVALVHKLNGVFGEDKSELNWETI 314 C ++ + G SA A + ++ E ++V ++G+FG +WE I Sbjct: 15 CIIIILISGVSADGAESDSAAKKEENPSIVKIISGIFGNKFPPSSWELI 63 >At5g13010.1 68418.m01491 RNA helicase, putative similar to DEAH-box RNA helicase [Chlamydomonas reinhardtii] GI:12044832; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 1226 Score = 28.7 bits (61), Expect = 3.3 Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 1/64 (1%) Frame = -3 Query: 595 EGHVVAVRVSTDSQYQILVTLSVQDLEVDLVVLPQSNELPADFRACFVLTVAEG-KSAIV 419 + + A S + + LV+ S +++ +L++LP ++LPAD +A +G + IV Sbjct: 747 QDEIEAACFSLKERMEQLVSSSSREI-TNLLILPIYSQLPADLQAKIFQKPEDGARKCIV 805 Query: 418 AVNI 407 A NI Sbjct: 806 ATNI 809 >At3g30550.1 68416.m03866 hypothetical protein includes At2g05890, At4g07450, At3g30630, At3g43100, At2g09960, At3g30550, At1g39430, At2g10460, At4g03640, At5g35250 Length = 509 Score = 28.7 bits (61), Expect = 3.3 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 1/69 (1%) Frame = +2 Query: 29 NAPKMKPVIVILCLFVASLYAA-DSDVPNDILEEQLYNSIVVADYDSAVEKSKHLYEEKK 205 N K K +LC+ +++ DS + + + + IV DYD+ V+ S + E+ Sbjct: 395 NCLKGKTFQFLLCVQRENIFGGYDSFTVARVYTDNIADEIVQEDYDAYVDPSSLISIEQD 454 Query: 206 SEVITNVVN 232 S ++TN V+ Sbjct: 455 SLMLTNGVD 463 >At1g16280.1 68414.m01949 DEAD/DEAH box helicase, putative similar to gb|L13612 DEAD-box protein (dbp45A) from Drosophila melanogaster and is a member of PF|00270 DEAD/DEAH box helicase family Length = 491 Score = 28.7 bits (61), Expect = 3.3 Identities = 22/71 (30%), Positives = 33/71 (46%) Frame = -3 Query: 514 VDLVVLPQSNELPADFRACFVLTVAEGKSAIVAVNIITQRQSETVALVHKLNGVFGEDKS 335 VDLV+ P D+ T G+ + AV+IIT+ V L+HK+ G+ Sbjct: 371 VDLVINYDIPRDPRDYVHRVGRTARAGRGGL-AVSIITETD---VKLIHKIEEEVGKKME 426 Query: 334 ELNWETITDDV 302 N + ITD + Sbjct: 427 PYNKKVITDSL 437 >At5g03800.1 68418.m00347 exostosin family protein / pentatricopeptide (PPR) repeat-containing protein contains Pfam profiles: PF03016 exostosin family, PF01535 PPR repeat Length = 1388 Score = 28.3 bits (60), Expect = 4.3 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -1 Query: 558 PNTKYWLRSVFKILK*TLLFSHRAMNFQLTFGLV 457 PNT+Y L+ V + +K + LF H A +T+G++ Sbjct: 806 PNTEYVLQEVDEFMKKSFLFHHSA-KLAVTYGIL 838 >At4g00730.1 68417.m00099 anthocyaninless2 (ANL2) nearly identical to Anthocyaninless2 [Arabidopsis thaliana] GI:5702094 Length = 802 Score = 28.3 bits (60), Expect = 4.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 527 NTERNQYLVLGVGTNPNGDHMAF 595 N N L L VGTN NG H AF Sbjct: 270 NHHYNSSLELAVGTNNNGGHFAF 292 >At5g16590.1 68418.m01942 leucine-rich repeat transmembrane protein kinase, putative Length = 625 Score = 27.9 bits (59), Expect = 5.7 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -3 Query: 364 LNGVFGEDKSELNWETITDDVLGALEPKLIGVLHAVHLVVSY 239 L+G G +S LNWET + LGA + I LH+ S+ Sbjct: 427 LHGNKGSGRSPLNWETRANIALGA--ARAISYLHSRDATTSH 466 >At2g04620.1 68415.m00470 cation efflux family protein potential member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, see PMID:11500563 Length = 798 Score = 27.9 bits (59), Expect = 5.7 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -3 Query: 136 VKLLLQNVVRDVGICSIQRCHEKT*NNYD 50 +K ++N+++ G+CSIQR H + N D Sbjct: 727 LKEAMRNILKTKGVCSIQRLHVWSFTNSD 755 >At1g06550.1 68414.m00694 enoyl-CoA hydratase/isomerase family protein similar to CHY1 [gi:8572760]; contains Pfam profile PF00388 enoyl-CoA hydratase/isomerase family protein Length = 387 Score = 27.9 bits (59), Expect = 5.7 Identities = 32/118 (27%), Positives = 55/118 (46%), Gaps = 4/118 (3%) Frame = +2 Query: 206 SEVITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVEFRL---IFAENAIKLMYK 376 +E IT V+ L R++ ++ Q +G K + DC EFRL I + MY Sbjct: 263 NEWITPVIKGLKRSSPTG-LKIVLQSIREGRKQTLSDCLKKEFRLTLNILRKTISPDMY- 320 Query: 377 RDGL-ALTLSNDVHGNDGRLAFGDGKDKTSPKVSWKFIALWENNKVYFKILNTERNQY 547 +G+ ALT+ D + D+ K++ F L+E++ + +I TE N++ Sbjct: 321 -EGIRALTIDKDNSPKWNPATLDEVDDE---KINSVF-KLFEDDDIELQIPETEENRW 373 >At5g07400.1 68418.m00847 forkhead-associated domain-containing protein / FHA domain-containing protein Length = 1084 Score = 27.5 bits (58), Expect = 7.6 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 2/80 (2%) Frame = -3 Query: 472 DFRACFVLT--VAEGKSAIVAVNIITQRQSETVALVHKLNGVFGEDKSELNWETITDDVL 299 D R FV+ V EG+ A + V++ + T + + VF ++E+N V Sbjct: 153 DGRVGFVVQEIVFEGRDASI-VSVSSGHSRGTFSSGKRSKRVFAPMENEIN-----SPVS 206 Query: 298 GALEPKLIGVLHAVHLVVSY 239 G PK +GV+ V+ +VSY Sbjct: 207 GFYPPKAVGVVERVNSLVSY 226 >At4g28590.1 68417.m04089 expressed protein Length = 331 Score = 27.5 bits (58), Expect = 7.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 370 HKLNGVFGEDKSELNWETITDD 305 H + V G+D SE++WE DD Sbjct: 180 HPIKNVVGDDGSEIDWEGEIDD 201 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,234,201 Number of Sequences: 28952 Number of extensions: 235332 Number of successful extensions: 945 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 920 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 945 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1255974912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -