BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c11r (734 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g08310.1 68417.m01372 expressed protein glutamic acid-rich pr... 32 0.45 At4g19230.2 68417.m02837 cytochrome P450 family protein cytochro... 31 0.60 At5g17930.1 68418.m02102 MA3 domain-containing protein low simil... 31 1.0 At5g17240.1 68418.m02020 SET domain-containing protein contains ... 29 3.2 At4g02710.1 68417.m00366 kinase interacting family protein simil... 29 4.2 At5g31412.1 68418.m03722 hypothetical protein contains Pfam doma... 28 5.6 At2g34780.1 68415.m04270 expressed protein 28 5.6 At1g66130.1 68414.m07505 oxidoreductase N-terminal domain-contai... 28 5.6 At2g26780.1 68415.m03212 expressed protein contains Pfam profile... 27 9.8 At2g04230.1 68415.m00410 F-box family protein contains F-box dom... 27 9.8 >At4g08310.1 68417.m01372 expressed protein glutamic acid-rich protein precursor - Plasmodium falciparum, PIR2:A54514 Length = 504 Score = 31.9 bits (69), Expect = 0.45 Identities = 21/59 (35%), Positives = 30/59 (50%) Frame = -1 Query: 719 DEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDGK 543 D K +K+H CL+ + DE N L+T + K + P+K+ A L K KDGK Sbjct: 77 DVHKSFVKQHLVQCLAGAENDETSENSLET-EKKDDVTPVKEAA--ELSKEHTTKKDGK 132 >At4g19230.2 68417.m02837 cytochrome P450 family protein cytochrome P450, Arabidopsis thaliana; supported by cDNA: gi_15293092_gb_AY050980.1_ Length = 484 Score = 31.5 bits (68), Expect = 0.60 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +2 Query: 383 ERASGLSRGSISHNSRLFGEGCCLCWPGKRQS 478 ERA+G S G +SR C LCWPG R+S Sbjct: 439 ERATGFSMG----HSRFPKTDCPLCWPGSRRS 466 >At5g17930.1 68418.m02102 MA3 domain-containing protein low similarity to SP|Q9P6R9 Cell cycle control protein cwf22 {Schizosaccharomyces pombe}; contains Pfam profile PF02847: MA3 domain Length = 707 Score = 30.7 bits (66), Expect = 1.0 Identities = 25/104 (24%), Positives = 47/104 (45%), Gaps = 2/104 (1%) Frame = -1 Query: 686 ADCLSETKADE--QLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDGKFKKDVALAKV 513 A+ ++ET E + LK + + N +K C+++ S+ F+K + L + Sbjct: 479 AEDIAETMDAEVVEAQKMLKLAEAQRMNTDSRKAIFCVIMSSEDYID--AFEKLLRL-DL 535 Query: 512 PNAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHEKDPKHAL 381 P +D+ + L++ CL K + T C H+K+ K L Sbjct: 536 PGKQDREIMRVLVECCLQEKAFNKFYTVLASKLCEHDKNHKFTL 579 >At5g17240.1 68418.m02020 SET domain-containing protein contains Pfam profile PF00856: SET domain Length = 491 Score = 29.1 bits (62), Expect = 3.2 Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = -1 Query: 602 LKKYALCMLI-KSQLMTKDGKFKKDVALAKVPNAEDKLKVEKLIDACLANKGNSPHQTAW 426 LKK L + + + LMT + KD+ L+ N + L +++ CL + + ++ W Sbjct: 57 LKKGELVLKVPRKALMTTESIIAKDLKLSDAVNLHNSLSSTQILSVCLLYEMSKEKKSFW 116 Query: 425 NYVKCYH 405 Y +H Sbjct: 117 -YPYLFH 122 >At4g02710.1 68417.m00366 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1111 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +2 Query: 362 DYVFTRKERASGLSRGSISHNSRLFGEGCCL 454 DYVFT +E A +S+G+ + L EG CL Sbjct: 781 DYVFTHRESAGEVSKGADLMDEFLKLEGMCL 811 >At5g31412.1 68418.m03722 hypothetical protein contains Pfam domain, PF04937: Protein of unknown function (DUF 659) Length = 433 Score = 28.3 bits (60), Expect = 5.6 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = -1 Query: 692 HRADCLSETKADEQLVNKLKT-GDFKTENEPLKKYALCMLIKSQLMTKD-GKFKKDVALA 519 H D + E + + K++T GD+K EN L +Y C+L + +D G K + LA Sbjct: 227 HTVDLMLEAISKLPKMGKMQTFGDYKGENLFLNRYESCVLEWCDVCVEDFGPLMKLLRLA 286 Query: 518 KVPN 507 N Sbjct: 287 DGEN 290 >At2g34780.1 68415.m04270 expressed protein Length = 1297 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +1 Query: 139 KRDKQSYDEHRRKLNFGSRSNMLQQLNKIYRTDID 243 +R+ Q + R KL FGS +N + L++ + TD++ Sbjct: 401 RREFQCEELGRLKLEFGSLTNRMNLLDEYFSTDVE 435 >At1g66130.1 68414.m07505 oxidoreductase N-terminal domain-containing protein similar to AX110P [Daucus carota] GI:285739; contains Pfam profile PF01408: Oxidoreductase family NAD-binding Rossmann fold Length = 364 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -1 Query: 539 KKDVALAKVPNAEDKLKVEKLIDACLANKGNSPHQTAW 426 KK L + P A+D ++EK+++AC N T W Sbjct: 95 KKKHVLVEKPPAQDATELEKIVEACEYNGVQFMDGTIW 132 >At2g26780.1 68415.m03212 expressed protein contains Pfam profile TBP (TATA-binding protein) -interacting protein 120 (TIP120); contains TIGRFAM profile TIGR01612: reticulocyte binding protein Length = 1866 Score = 27.5 bits (58), Expect = 9.8 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -3 Query: 471 RLPGQQRQQPSPNSLELCEMLPRERPE 391 R P ++R++ +PN+LE LP++ E Sbjct: 114 RAPAKEREEIAPNTLENVSKLPKQHQE 140 >At2g04230.1 68415.m00410 F-box family protein contains F-box domain Pfam:PF00646 Length = 448 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -1 Query: 509 NAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHE 402 ++ KL++ KL D L + +P + WN KC E Sbjct: 333 DSSPKLQILKLTDVYLHDNKTNPDERKWNPPKCAPE 368 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,175,685 Number of Sequences: 28952 Number of extensions: 309664 Number of successful extensions: 786 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 770 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 786 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1614253080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -