BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c10r (744 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5AKS1 Cluster: Putative uncharacterized protein; n=1; ... 33 7.4 >UniRef50_Q5AKS1 Cluster: Putative uncharacterized protein; n=1; Candida albicans|Rep: Putative uncharacterized protein - Candida albicans (Yeast) Length = 109 Score = 33.1 bits (72), Expect = 7.4 Identities = 29/95 (30%), Positives = 43/95 (45%) Frame = -2 Query: 395 FCCNTYT**VFISYKFVKLLKYTLCTPTRLVCFRKSASYQFLNH*NCFDIIFSKNNDYYK 216 FCC VF+ +K + K + C C SYQ L+ C I+ S NN+ K Sbjct: 17 FCCCVLNL-VFMQHK--RCSKPSTCNQILSCCCCTRVSYQLLSQIQCHLIVDSFNNE-NK 72 Query: 215 ESETIDWQLYIQFERCL*MM*FISYNIFQCKMIFV 111 ESE + W +Q CL ++ F N+ C + + Sbjct: 73 ESEGV-WGWSLQ---CL-LLLFTKVNLRSCDQLLI 102 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 668,014,775 Number of Sequences: 1657284 Number of extensions: 13055212 Number of successful extensions: 23587 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 22649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23579 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 60911752460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -