BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c10f (636 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 24 4.6 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 24 4.6 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 24 4.6 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 23 6.1 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 23 8.1 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.8 bits (49), Expect = 4.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 Query: 314 LSISTLSGLVLFFLMTLLAFPQPPIITSYIG 222 LSIS L L +FFL+ + P ++ +G Sbjct: 277 LSISILISLHVFFLLVVEIIPPTSLVVPLLG 307 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.8 bits (49), Expect = 4.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 Query: 314 LSISTLSGLVLFFLMTLLAFPQPPIITSYIG 222 LSIS L L +FFL+ + P ++ +G Sbjct: 277 LSISILISLHVFFLLVVEIIPPTSLVVPLLG 307 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 23.8 bits (49), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 314 LSISTLSGLVLFFLMTLLAFPQPPIITSYIG 222 LSIS L L +FFL+ P ++ +G Sbjct: 273 LSISILLSLTVFFLLLAEIIPPTSLVVPLLG 303 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 23.4 bits (48), Expect = 6.1 Identities = 15/59 (25%), Positives = 24/59 (40%) Frame = +1 Query: 76 TIMANVMDVATDDNLQYQFFPVSSGSVQFKVRAANDAHIALTTGPQESDPMYEVMIGGW 252 T A V TD+N+QY + + F V +ND I+ +++ P W Sbjct: 473 TFSARVGRGLTDENMQYMYRKAYRDKLSFSV--SNDQMISFAQFCKDTTPECNYTFWEW 529 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +2 Query: 539 PPLATLEATEETYPLRLEEPVYGLMFQE 622 PP+A++EA + T+ ++ P Y + Q+ Sbjct: 314 PPVASVEAVKFTHIFQILPPSYDRLCQQ 341 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 622,012 Number of Sequences: 2352 Number of extensions: 13252 Number of successful extensions: 129 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 129 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -