BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c08r (733 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 27 0.21 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 27 0.21 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 24 1.1 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 26.6 bits (56), Expect = 0.21 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = +3 Query: 570 TDNTLLTCSNLYFLYRSPHGVGLFK*TPDGLFPKYVRTASFKLSSXILNL 719 T N L T S+ LY + V F + +FP Y+RT S I+ L Sbjct: 33 TSNYLYTPSSTIDLYNTS-SVSNFNESSSSVFPNYIRTTSMVFCIIIMCL 81 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 26.6 bits (56), Expect = 0.21 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = +3 Query: 570 TDNTLLTCSNLYFLYRSPHGVGLFK*TPDGLFPKYVRTASFKLSSXILNL 719 T N L T S+ LY + V F + +FP Y+RT S I+ L Sbjct: 33 TSNYLYTPSSTIDLYNTS-SVSNFNESSSSVFPNYIRTTSMVFCIIIMCL 81 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 24.2 bits (50), Expect = 1.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 297 IDSVTXSLLPQVDVYEKPVLPLTLVNITFIS 389 ID + + +V VY+ PVL L L T++S Sbjct: 114 IDKIFKTRDDRVKVYQAPVLQLFLYIFTYLS 144 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,993 Number of Sequences: 336 Number of extensions: 3113 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19571740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -