BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c08r (733 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018) 31 0.73 SB_36259| Best HMM Match : PHD (HMM E-Value=5.3e-05) 30 1.7 SB_15750| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_41295| Best HMM Match : FTCD (HMM E-Value=5.6) 28 6.8 SB_12109| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_14272| Best HMM Match : Sugar_tr (HMM E-Value=0.0046) 28 9.0 >SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018) Length = 3561 Score = 31.5 bits (68), Expect = 0.73 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -3 Query: 275 YGSGVTAGSGDHSRFIGIHRGLGSGGRV 192 YGS G G F+G H G G+GGRV Sbjct: 1788 YGSIRANGGGSPQEFLGRHGGAGAGGRV 1815 >SB_36259| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 790 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +1 Query: 610 CTDRPMALDFSSRLRTDSSRNTFALHPSNCHRRY 711 CT P+AL SS+L DS N F +HP +++Y Sbjct: 5 CTFTPIALLLSSKLDFDSPEN-FLIHPGLIYQQY 37 >SB_15750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 29.1 bits (62), Expect = 3.9 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 3/59 (5%) Frame = -1 Query: 175 GNVVVNFKRSHNGHHXWGPPIQKXLTTAGITNEF--TAMETISFGFNV-DASXKVSIGN 8 G V +N KRS + +Q +A N+F T T+SFG V +A+ VSI N Sbjct: 127 GTVTINLKRSSTTFEAFSLELQTTNRSAVQGNDFSYTNPTTVSFGILVNEATTTVSITN 185 >SB_41295| Best HMM Match : FTCD (HMM E-Value=5.6) Length = 322 Score = 28.3 bits (60), Expect = 6.8 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 276 PXLAPIVIDSVTXSLLPQVDVYEKPVL 356 P L+ IVI + SL ++D+Y+KPV+ Sbjct: 12 PNLSVIVILNFITSLFSKLDIYDKPVV 38 >SB_12109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4085 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = -1 Query: 163 VNFKRSHNGH-HXWGPPIQKXLTTAGITNEFTAMETISFGFNVDASXKVS 17 + F R + G+ H PP+ T GI + F + + GFN+ VS Sbjct: 1517 LQFVRQYEGYQHIPAPPLSMICTLCGIISGFFDLIMANGGFNIQEQTLVS 1566 >SB_14272| Best HMM Match : Sugar_tr (HMM E-Value=0.0046) Length = 775 Score = 27.9 bits (59), Expect = 9.0 Identities = 18/67 (26%), Positives = 30/67 (44%) Frame = -1 Query: 421 KAFSITQEIEYDINVMFTKVSGKTGFSYTSTWGKSEXVTESITIGASXGMEAELQPGQAI 242 K FS + + +V+ +V+G++ + S GKS TES+ +S E + Sbjct: 538 KVFSASPRVLSKSSVISVRVTGESSVTTESVLGKSSVTTESVFGKSSVTSEIGFPYRKCF 597 Query: 241 TAVLSAY 221 VL Y Sbjct: 598 RQVLGNY 604 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,125,098 Number of Sequences: 59808 Number of extensions: 421233 Number of successful extensions: 1185 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1044 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1183 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -