BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c07f (600 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 40 2e-05 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 23 1.7 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 22 5.3 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 7.0 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 9.2 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 9.2 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 39.9 bits (89), Expect = 2e-05 Identities = 19/79 (24%), Positives = 45/79 (56%), Gaps = 6/79 (7%) Frame = +2 Query: 203 GGTCGGSIISPKWILTAGHCTLFTNGH--YVLAG----TNKSDDQSGIIRYVKRMVIHPL 364 G CG +IIS +++LTA HC + N ++ G ++K++ + ++ + +++IHP Sbjct: 185 GMICGATIISKRYVLTAAHCIIDENTTKLAIVVGEHDWSSKTETNATVLHSINKVIIHPK 244 Query: 365 FSVGPYWLDVEDFNLKQVA 421 + + ++ +D+ + +A Sbjct: 245 YDI----IEKDDWQINDIA 259 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 23.4 bits (48), Expect = 1.7 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +2 Query: 194 VLFGGTCGGSIISPKWILTA-GHCTLFTNGHYVL 292 VL G TC GS I W+ A +F+ G ++L Sbjct: 575 VLAGATCLGSSIKAMWLRRALASLMVFSLGLFLL 608 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 234 RNGSSLRDTAHCS 272 +NGS + DTA CS Sbjct: 200 KNGSVILDTARCS 212 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.4 bits (43), Expect = 7.0 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +3 Query: 51 RWRQVRARYLNPAPMTYRI*NKNLRW 128 +W QV A +LN +P ++ N + W Sbjct: 653 KWLQVLALWLNHSPNYDQVTNWYMGW 678 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 109 KTKICAGNN*NYKD 150 +TKI + NN NYK+ Sbjct: 300 ETKIISSNNYNYKN 313 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 109 KTKICAGNN*NYKD 150 +TKI + NN NYK+ Sbjct: 311 ETKIISSNNYNYKN 324 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,763 Number of Sequences: 438 Number of extensions: 4093 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -