BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c07f (600 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g69740.1 68414.m08025 porphobilinogen synthase, putative / de... 29 3.1 At5g66100.1 68418.m08327 La domain-containing protein similar to... 28 4.1 At3g45700.1 68416.m04939 proton-dependent oligopeptide transport... 28 4.1 At5g62660.1 68418.m07864 F-box family protein contains Pfam prof... 28 5.4 At1g44318.1 68414.m05109 porphobilinogen synthase, putative / de... 28 5.4 At5g06220.1 68418.m00694 expressed protein 27 9.5 >At1g69740.1 68414.m08025 porphobilinogen synthase, putative / delta-aminolevulinic acid dehydratase, putative similar to delta-aminolevulinic acid dehydratase (Alad) GI:493019 [SP|P43210] from Glycine max, SP|P24493 from Spinacia oleracea, SP|P30124 from Pisum sativum Length = 430 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +2 Query: 476 KTIKVATLDDQPNLPIGVDVGYAGYGTDEHGGVMRKD 586 +TI++ D P+L I DV Y +D H G++R+D Sbjct: 203 RTIRLLK-DKYPDLIIYTDVALDPYSSDGHDGIVRED 238 >At5g66100.1 68418.m08327 La domain-containing protein similar to SP|P40796 La protein homolog (La ribonucleoprotein) (La autoantigen homolog) {Drosophila melanogaster}; contains Pfam profile PF05383: La domain Length = 453 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -3 Query: 280 TVREQCAVSRSE-DPFRANNGTSTGTTEKN 194 T E AV+ S+ PFR NN TS+ +T N Sbjct: 154 TSSENSAVNNSQRKPFRRNNNTSSSSTSSN 183 >At3g45700.1 68416.m04939 proton-dependent oligopeptide transport (POT) family protein contains Pfam profile: PF00854 POT family Length = 548 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/65 (24%), Positives = 32/65 (49%) Frame = -1 Query: 333 RIMPLWSSDLLVPANT**PFVNSVQCPAVRIHFGLIMEPPQVPPKRTACGNLSCTAFTSD 154 R++PLW+S + + A P + ++ ++M+ P + + G++ A S Sbjct: 315 RLVPLWTSVMFLSA----PLAVQMSMTVLQ---AMVMDRKLGPHFKVSAGSMQVIALVSG 367 Query: 153 CVFVI 139 CVF+I Sbjct: 368 CVFII 372 >At5g62660.1 68418.m07864 F-box family protein contains Pfam profile: PF00646 F-box domain Length = 379 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -2 Query: 119 IFVLNPVCHWRRVEVARTHLP 57 +FVL P W+R+E + HLP Sbjct: 221 VFVLEPGGSWKRIEFDQPHLP 241 >At1g44318.1 68414.m05109 porphobilinogen synthase, putative / delta-aminolevulinic acid dehydratase, putative similar to delta-aminolevulinic acid dehydratase (Alad) GI:493019 [SP|P43210] from Glycine max, SP|P24493 from Spinacia oleracea, SP|P30124 from Pisum sativum Length = 406 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 500 DDQPNLPIGVDVGYAGYGTDEHGGVMRKD 586 D P+L I DV + Y T HGG++ +D Sbjct: 187 DRFPDLVIYTDVNFDEYSTTGHGGIVGED 215 >At5g06220.1 68418.m00694 expressed protein Length = 813 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 271 EQCAVSRSEDPFRANNGTSTGTTEKNGMWKPFV 173 EQ R +DP + N GT+ +G W FV Sbjct: 567 EQSQYLRGKDPKNSINSVDQGTSRDSGFWGFFV 599 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,749,747 Number of Sequences: 28952 Number of extensions: 284375 Number of successful extensions: 646 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1187288784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -