BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c06r (786 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59210.2 68418.m07421 myosin heavy chain-related contains wea... 32 0.38 At5g59210.1 68418.m07420 myosin heavy chain-related contains wea... 32 0.38 At1g64255.1 68414.m07280 SWIM zinc finger family protein contain... 32 0.50 At1g69390.1 68414.m07966 chloroplast division protein, putative ... 30 2.0 At3g42670.1 68416.m04437 SNF2 domain-containing protein / helica... 29 2.6 At5g62220.1 68418.m07813 exostosin family protein contains Pfam ... 28 6.1 At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A... 28 6.1 At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A... 28 6.1 >At5g59210.2 68418.m07421 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 433 Score = 32.3 bits (70), Expect = 0.38 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = -2 Query: 746 ELSADTSNQDLE-EKLY--NSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRR 579 +L + NQ E EKL+ NS L+ Y ++ S ++E+Q K + QNV ++DK R Sbjct: 285 KLLMEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLR 343 >At5g59210.1 68418.m07420 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 434 Score = 32.3 bits (70), Expect = 0.38 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = -2 Query: 746 ELSADTSNQDLE-EKLY--NSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRR 579 +L + NQ E EKL+ NS L+ Y ++ S ++E+Q K + QNV ++DK R Sbjct: 286 KLLMEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLR 344 >At1g64255.1 68414.m07280 SWIM zinc finger family protein contains Pfam profile PF04434: SWIM zinc finger Length = 750 Score = 31.9 bits (69), Expect = 0.50 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 599 LIIDKRRNTMEYCYKLWVGNGQEIVRKYFPLNF 501 +++D + EY KL + +G + KYFPL F Sbjct: 386 IVVDTKNLNCEYQLKLMIASGVDAANKYFPLAF 418 >At1g69390.1 68414.m07966 chloroplast division protein, putative (MinE1) identical to chloroplast division protein homolog MinE1 GI:17511220 from [Arabidopsis thaliana] Length = 229 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -2 Query: 773 MLAASAGVVELSADTSNQDLEEKLYNSILTGDYD 672 +LA + G ELS + Q++E LYN+I G +D Sbjct: 70 VLARNTGDYELSPSPAEQEIESFLYNAINMGFFD 103 >At3g42670.1 68416.m04437 SNF2 domain-containing protein / helicase domain-containing protein low similarity to SP|P41410 DNA repair protein rhp54 (RAD54 homolog) {Schizosaccharomyces pombe}; contains PFam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 1256 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/59 (27%), Positives = 29/59 (49%) Frame = +1 Query: 58 PATSPSCPTALRSPEAFTIVPSSKASLNWRL*MKNRTSFSYLAGWKNHCSLVLSALLPP 234 P S P+A S ++++P K L+ + + +F +L WKN V+ A++ P Sbjct: 648 PVASSDMPSAEESDNVWSLIPQLKRKLH----LHQKKAFEFL--WKNLAGSVVPAMMDP 700 >At5g62220.1 68418.m07813 exostosin family protein contains Pfam profile: PF03016 Exostosin family Length = 517 Score = 28.3 bits (60), Expect = 6.1 Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 4/61 (6%) Frame = +1 Query: 58 PATSPSCPTAL----RSPEAFTIVPSSKASLNWRL*MKNRTSFSYLAGWKNHCSLVLSAL 225 P ++PS P L R+P++ T + K S N + NR+S Y+A ++HC+ ++ +L Sbjct: 3 PVSNPSSPEHLLKKSRTPDSTTSI-DRKNSFNSLHSVGNRSS--YIAASRSHCTWLILSL 59 Query: 226 L 228 L Sbjct: 60 L 60 >At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 390 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -2 Query: 707 KLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLII 591 K+ + IL+G D A EY Q K IQN++NN ++ Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMV 141 >At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 497 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -2 Query: 707 KLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLII 591 K+ + IL+G D A EY Q K IQN++NN ++ Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMV 141 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,215,659 Number of Sequences: 28952 Number of extensions: 328133 Number of successful extensions: 869 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 840 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 869 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1765546400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -