BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c06f (627 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_12544| Best HMM Match : DUF1218 (HMM E-Value=2.7) 25 1.4 SB_52928| Best HMM Match : PKD (HMM E-Value=0) 29 4.1 SB_26361| Best HMM Match : fn3 (HMM E-Value=0) 29 4.1 SB_42815| Best HMM Match : rve (HMM E-Value=0.00022) 29 4.1 SB_49700| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_20858| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_53155| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_23517| Best HMM Match : WD40 (HMM E-Value=0) 27 9.4 >SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 441 Score = 33.5 bits (73), Expect = 0.14 Identities = 20/65 (30%), Positives = 27/65 (41%) Frame = -2 Query: 302 CRPTACSSTPWCSVSCQ*SGC*LHSG*WSPCLGSHIPSSDGQHCRSRR*GCCCTVSPRGL 123 C+ CS++ C SC GC L+ + + C+SR G CT S G Sbjct: 224 CQQVVCSASGKCDQSCDGEGCNLYCSEGAKTCNQKCQGACVTDCKSRWCGVTCTGS--GC 281 Query: 122 G*KCP 108 KCP Sbjct: 282 DVKCP 286 >SB_12544| Best HMM Match : DUF1218 (HMM E-Value=2.7) Length = 290 Score = 25.4 bits (53), Expect(2) = 1.4 Identities = 8/28 (28%), Positives = 18/28 (64%) Frame = +2 Query: 236 VNNLIIDKRRNTMEYCYKLWVGNGQEIV 319 +++L++ +++ YC+ NGQ+IV Sbjct: 130 IHDLLLSLQKHLFAYCHNATSNNGQDIV 157 Score = 23.4 bits (48), Expect(2) = 1.4 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = +2 Query: 317 VRKYFPLNFRLIMAGNYVKIIYRNYNLALKLGSTTNPSNERIAYGDGVDKH 469 +R YF L+M+G ++ + +L L S R+ G G D H Sbjct: 183 IRYYFACFQELLMSGPANSLLQSHLSLFLPCAGEILGSVYRLLVGHGSDTH 233 >SB_52928| Best HMM Match : PKD (HMM E-Value=0) Length = 1624 Score = 28.7 bits (61), Expect = 4.1 Identities = 30/113 (26%), Positives = 49/113 (43%), Gaps = 3/113 (2%) Frame = -1 Query: 363 FPAMMSLKFNGKYFLTISCPLPTHSL*QYSMVFRLLSMIRLLTTFWMMEPLP---WLSYS 193 FPAM +L NG + +++ SL ++ R R L M P+ W S Sbjct: 519 FPAMAALTMNGSHAVSLWSYGDGSSLKKHESGPRQFITSRHLYAHTGMFPVTVTVWNRLS 578 Query: 192 KL*RTALS*SPVRMLLYSFSSRSWLEVSADSSTTPALAASMHIANTTRSFILL 34 K TAL+ V++ + + S S L S +S T + + H T S+ ++ Sbjct: 579 KKNETALAYVSVQVPVTNISVPSDLTASLGNSVTFTVKITSHETPTNASYYII 631 >SB_26361| Best HMM Match : fn3 (HMM E-Value=0) Length = 1898 Score = 28.7 bits (61), Expect = 4.1 Identities = 27/74 (36%), Positives = 33/74 (44%), Gaps = 5/74 (6%) Frame = +2 Query: 401 LKLGSTTNPSNERIAYGDGVDKHTELVSWKFITLWENNRVYFKIHNTKYNQYLKMS---- 568 L+ GST S++ IA +T L S F R Y H T Y YL +S Sbjct: 868 LESGSTLLASDDGIAPNKRTKVYTSLSSDVFY------RFYVYAHTT-YTTYLCLSVNAP 920 Query: 569 -TTTCNCNSRDRVV 607 T C NSRDRV+ Sbjct: 921 CTQACRLNSRDRVL 934 >SB_42815| Best HMM Match : rve (HMM E-Value=0.00022) Length = 1514 Score = 28.7 bits (61), Expect = 4.1 Identities = 22/82 (26%), Positives = 31/82 (37%), Gaps = 1/82 (1%) Frame = +3 Query: 75 SPPARASLNYPRTLLTKTSRRNCTTASSPATTTVLSVRAWNM-RAKARAPXXXXXXXXXX 251 +PP+R S R+ SR T S+P T + S RA + +AK A Sbjct: 1359 APPSRTSTPRSRSTPRSRSRSRTRTPSTPFTPSTTSSRASSRGKAKGGAKTTKTTKKCTT 1418 Query: 252 XXXDGTPWSTATSCGSATDRKL 317 G T T T R++ Sbjct: 1419 RKSRGQNGDTTTKTKCITTRRV 1440 >SB_49700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 7645 Score = 28.3 bits (60), Expect = 5.4 Identities = 20/94 (21%), Positives = 42/94 (44%), Gaps = 1/94 (1%) Frame = -3 Query: 439 SLIRGIGCGTELQSEVVVSVNDLDIVSGHDESKV*WEVLSNNFLSVADPQLVAVLHG-VP 263 S++ G E V++ +N+ IV + K+ + +++ +V ++ V Sbjct: 6471 SVVEAFEAG-ETSKPVMIPINEDKIVEDTETFKLLLSSIEPTVTVISNQTIVNIIDDDVI 6529 Query: 262 SLVNDQVVNYILDDGXXXXXLIFQALTDSTVVVA 161 ++N VVN I +DG Q+LT +++ Sbjct: 6530 VIINQTVVNIIDNDGKLSSSSTRQSLTSLMTILS 6563 >SB_20858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 337 KL*THHGRKLCQDHLQKLQPRSEAR 411 +L HHGR+L +DHL PR R Sbjct: 199 RLLKHHGRELIKDHLDLPLPRQPKR 223 >SB_53155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 412 Score = 27.9 bits (59), Expect = 7.1 Identities = 18/66 (27%), Positives = 29/66 (43%) Frame = +2 Query: 350 IMAGNYVKIIYRNYNLALKLGSTTNPSNERIAYGDGVDKHTELVSWKFITLWENNRVYFK 529 ++ G Y +++R ++ + G+ T SNER V K + F W VYF Sbjct: 217 VITGLYSGVVHRLWHRKVP-GNQTTSSNERAKSKKRVLKMLVAIVLAFALCWLPYHVYFF 275 Query: 530 IHNTKY 547 + N Y Sbjct: 276 LENYYY 281 >SB_23517| Best HMM Match : WD40 (HMM E-Value=0) Length = 860 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 6/38 (15%) Frame = +3 Query: 126 TSRRNCTTASSPATTTVLS------VRAWNMRAKARAP 221 TSR NC + P +T ++S +R W+ R++++ P Sbjct: 655 TSRVNCVKFNQPDSTVIISGSYDSTIRCWDCRSRSQEP 692 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,060,738 Number of Sequences: 59808 Number of extensions: 391989 Number of successful extensions: 1094 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 996 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1091 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -