BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c03r (779 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC83.11 |||triose phosphate transporter|Schizosaccharomyces po... 27 4.0 SPCC162.01c |||RNA-binding protein |Schizosaccharomyces pombe|ch... 26 5.3 SPAC19A8.08 |upf2||nonsense-mediated decay protein Upf2|Schizosa... 26 7.0 SPAC607.06c |||metallopeptidase|Schizosaccharomyces pombe|chr 1|... 25 9.2 >SPBC83.11 |||triose phosphate transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 434 Score = 26.6 bits (56), Expect = 4.0 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = +1 Query: 94 FFQMCFAFLLLSLIFFNNHNALSVHKDVYYIRKFIIYFSSMFLNHTQ 234 FFQ AF LLS+I ++ S+ K ++ I II+F N TQ Sbjct: 236 FFQNILAFTLLSIISPVAYSIASLIKRIFVIVVSIIWFQQA-TNFTQ 281 >SPCC162.01c |||RNA-binding protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 244 Score = 26.2 bits (55), Expect = 5.3 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +1 Query: 634 DRVTRRDPMSGTDDEGRGL-RKRHH 705 DR RRD +S EG GL RKR H Sbjct: 109 DRKERRDGVSPFSPEGEGLERKREH 133 >SPAC19A8.08 |upf2||nonsense-mediated decay protein Upf2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1049 Score = 25.8 bits (54), Expect = 7.0 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -3 Query: 705 VMTFSETTPFIICSRHWITPCYPICI-QFS*IYVRSIAPILE 583 V SE T F + H + CY +CI +F+ + +A +LE Sbjct: 543 VRYISELTKFQLMPFHMVFECYKLCINEFTPFDLEVLALLLE 584 >SPAC607.06c |||metallopeptidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 612 Score = 25.4 bits (53), Expect = 9.2 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -2 Query: 697 VFGDHALHHLFPTLDHAVLPYLYPVFLD 614 VFG H+LH FP + L Y+ PVF D Sbjct: 250 VFGSHSLHS-FP----SALEYVVPVFSD 272 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,897,254 Number of Sequences: 5004 Number of extensions: 56522 Number of successful extensions: 123 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 123 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 377352472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -