BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c03r (779 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 6.1 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 24 6.1 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 23 8.0 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.8 bits (49), Expect = 6.1 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -2 Query: 445 ILCFLCNNIIIKNVFM 398 I+ F+C N I+ NVF+ Sbjct: 696 IILFICGNYILLNVFL 711 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = -2 Query: 151 YDY*KKLKIAIKKRNTFEKISAYSVSYI*DYASTSLDLPY 32 Y++ + + A+K N + YS +++ D+A L+L Y Sbjct: 863 YEFSQNAQAAVKHLNPRDFSLQYSGTFLRDFAFKELELSY 902 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 23.4 bits (48), Expect = 8.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 670 LFPTLDHAVLPYLYPVFL 617 L P L H +P LY VFL Sbjct: 926 LTPLLSHIPMPVLYGVFL 943 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 719,979 Number of Sequences: 2352 Number of extensions: 14083 Number of successful extensions: 237 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 236 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 237 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81497388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -