BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c03f (607 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3835| Best HMM Match : Cyt-b5 (HMM E-Value=4.8e-23) 46 2e-05 SB_34578| Best HMM Match : Cyt-b5 (HMM E-Value=4.8e-23) 46 2e-05 SB_49983| Best HMM Match : Cyt-b5 (HMM E-Value=8.4e-12) 46 2e-05 SB_23882| Best HMM Match : Cyt-b5 (HMM E-Value=9.2e-19) 44 7e-05 SB_31956| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47216| Best HMM Match : Oxidored_molyb (HMM E-Value=0) 36 0.019 SB_40386| Best HMM Match : BAR (HMM E-Value=0) 33 0.18 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_42860| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_32006| Best HMM Match : Glyco_hydro_67N (HMM E-Value=3.1) 28 6.7 SB_27122| Best HMM Match : I-set (HMM E-Value=1.9e-39) 28 6.7 SB_49216| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_55435| Best HMM Match : RVT_1 (HMM E-Value=7.9e-22) 27 8.9 SB_49546| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_49303| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0037) 27 8.9 SB_47063| Best HMM Match : APOBEC_C (HMM E-Value=0.41) 27 8.9 SB_47062| Best HMM Match : APOBEC_C (HMM E-Value=4.5) 27 8.9 SB_46566| Best HMM Match : APOBEC_C (HMM E-Value=4.5) 27 8.9 SB_45426| Best HMM Match : APOBEC_C (HMM E-Value=4.5) 27 8.9 SB_43798| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_43614| Best HMM Match : APOBEC_C (HMM E-Value=4.5) 27 8.9 SB_31068| Best HMM Match : DUF240 (HMM E-Value=2.1) 27 8.9 SB_26582| Best HMM Match : APOBEC_C (HMM E-Value=4.5) 27 8.9 SB_21916| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_18259| Best HMM Match : APOBEC_C (HMM E-Value=4.5) 27 8.9 SB_15817| Best HMM Match : APOBEC_C (HMM E-Value=0.41) 27 8.9 SB_6637| Best HMM Match : Phage_integr_N (HMM E-Value=1.4) 27 8.9 SB_2753| Best HMM Match : APOBEC_C (HMM E-Value=4.5) 27 8.9 SB_1614| Best HMM Match : APOBEC_C (HMM E-Value=4.5) 27 8.9 SB_59032| Best HMM Match : APOBEC_C (HMM E-Value=4.5) 27 8.9 SB_56361| Best HMM Match : APOBEC_C (HMM E-Value=4.5) 27 8.9 SB_46231| Best HMM Match : APOBEC_C (HMM E-Value=4.5) 27 8.9 SB_45162| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_44595| Best HMM Match : APOBEC_C (HMM E-Value=4.5) 27 8.9 SB_37211| Best HMM Match : APOBEC_C (HMM E-Value=4.5) 27 8.9 SB_31191| Best HMM Match : APOBEC_C (HMM E-Value=4.5) 27 8.9 SB_18421| Best HMM Match : APOBEC_C (HMM E-Value=4.5) 27 8.9 SB_9226| Best HMM Match : APOBEC_C (HMM E-Value=4.5) 27 8.9 SB_9027| Best HMM Match : Phage_fiber_2 (HMM E-Value=5.8) 27 8.9 >SB_3835| Best HMM Match : Cyt-b5 (HMM E-Value=4.8e-23) Length = 109 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Frame = +1 Query: 205 AEGLWRV-HNGIYNFNDFLEKHPGGAEWLELSKGTDITEAFESHHLNSSVNKVLEKYYVR 381 A G W V HN +++ FL++HPGG E L G D +E+FE +S +++ +Y + Sbjct: 21 AGGCWLVIHNKVFDVTKFLDEHPGGEEVLLEQAGGDASESFEDVGHSSDARELMNEYCIG 80 Query: 382 EAK 390 E + Sbjct: 81 ELR 83 >SB_34578| Best HMM Match : Cyt-b5 (HMM E-Value=4.8e-23) Length = 172 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Frame = +1 Query: 205 AEGLWRV-HNGIYNFNDFLEKHPGGAEWLELSKGTDITEAFESHHLNSSVNKVLEKYYVR 381 A G W V HN +++ FL++HPGG E L G D +E+FE +S +++ +Y + Sbjct: 21 AGGCWLVIHNKVFDVTKFLDEHPGGEEVLLEQAGGDASESFEDVGHSSDARELMNEYCIG 80 Query: 382 EAK 390 E + Sbjct: 81 ELR 83 >SB_49983| Best HMM Match : Cyt-b5 (HMM E-Value=8.4e-12) Length = 303 Score = 46.0 bits (104), Expect = 2e-05 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 6/90 (6%) Frame = +1 Query: 199 DGAEGLWRVH-NGIYNFNDFLEKHPGGAEWLELSKGTDITEAFESH--HLNSSVNKVLEK 369 D G+W + +G+Y+ DF+E+HPGG + + L+ G+ + + H H + K+L + Sbjct: 168 DARHGVWTTYEDGVYDLTDFIEQHPGGKKMIMLAAGSRLDPYWNIHDFHKRDDIVKILSE 227 Query: 370 YYV---REAKTPRNSPFTFEDDGFYRTLKR 450 + + R+ K ++ DD + R KR Sbjct: 228 FRIGSLRKEKIKASTGLNL-DDPYSRDPKR 256 >SB_23882| Best HMM Match : Cyt-b5 (HMM E-Value=9.2e-19) Length = 167 Score = 44.4 bits (100), Expect = 7e-05 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = +1 Query: 181 IGKSMDDGAEGLWRVHNG-IYNFNDFLEKHPGGAEWLELSKGTDITEAFESHHLN 342 IG+ DG LW +H+G +Y+ + F E+HPGG + L L+ G D+T + ++ Sbjct: 15 IGRHKSDG--DLWVIHSGKVYDISKFSERHPGGKDVLLLNSGQDVTSIMSNGEIH 67 >SB_31956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 319 Score = 43.6 bits (98), Expect = 1e-04 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = +1 Query: 223 VHNGIYNFNDFLEKHPGGAEWLELSKGTDITEAFESHH 336 +H +Y+ +FL +HPGG E L + G D+T FE++H Sbjct: 43 IHGKVYDVTNFLLRHPGGKELLLIGAGRDVTLVFETYH 80 >SB_47216| Best HMM Match : Oxidored_molyb (HMM E-Value=0) Length = 672 Score = 36.3 bits (80), Expect = 0.019 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 3/76 (3%) Frame = +1 Query: 214 LWRVHNG-IYNFNDFLEKHPGGAEWLELSKGTDITE--AFESHHLNSSVNKVLEKYYVRE 384 +W + G +Y+ DF++ HPGG + L+ G + A + H V ++LE+Y + + Sbjct: 219 IWVTYKGGVYDITDFIDGHPGGTSKIILAAGAALEPYWAMYAVHKKEEVLEILEEYRIGD 278 Query: 385 AKTPRNSPFTFEDDGF 432 EDD F Sbjct: 279 LAHEDQVIEFKEDDPF 294 >SB_40386| Best HMM Match : BAR (HMM E-Value=0) Length = 369 Score = 33.1 bits (72), Expect = 0.18 Identities = 19/57 (33%), Positives = 28/57 (49%) Frame = +1 Query: 43 NMAPKNVEYIEIAHRRAAEKKTHVSFPQLKYPSLRDEGLRDPVQWLIGKSMDDGAEG 213 N+ PK EY++ A+ K H++ P KYP EGL V L G+ + +G Sbjct: 51 NLTPKTKEYLQPNATYNAKVKMHMTQPDEKYP--YTEGLMGDVMMLAGQEIGQVGKG 105 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 32.7 bits (71), Expect = 0.24 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 349 VNKVLEKYYVREAKTPRNSPFTFEDDGFYRTLKRAVVEELKKVPK 483 ++KV K KTPR SP DDG R R +++ + P+ Sbjct: 1120 LSKVSRKVRKASLKTPRPSPGKLRDDGITRPASRVSAQQISRKPR 1164 >SB_42860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +1 Query: 64 EYIEIAHRRAAEKKTHVSFPQLKYPSLRDEG 156 E IA R AEK++H +F +K+PS+ + G Sbjct: 118 ERSSIAKRTMAEKESHSTFRIIKFPSVPEAG 148 >SB_32006| Best HMM Match : Glyco_hydro_67N (HMM E-Value=3.1) Length = 497 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 292 LSKGTDITEAFESHHLNSSVNKVLEKY 372 +S G D+T E H LN + + L+KY Sbjct: 248 VSHGVDVTNLPEDHRLNVIIREYLDKY 274 >SB_27122| Best HMM Match : I-set (HMM E-Value=1.9e-39) Length = 378 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -3 Query: 221 RHKPSAPS-SMDFPINHCTGSLNPSSLSEGYLS 126 ++KPS S S D +N TGSL + +S+GY S Sbjct: 203 KYKPSILSKSPDQTVNETTGSLKLTCISDGYPS 235 >SB_49216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 773 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 423 IFKSKRRIPRCFSFPNVIFLENFIHR 346 ++ S P CF+ PN I LE +HR Sbjct: 280 VYISSNESPNCFTSPNPIMLEPRMHR 305 >SB_55435| Best HMM Match : RVT_1 (HMM E-Value=7.9e-22) Length = 726 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 45 SHGVDVTNLPEDHRLNVIIREYLDKY 70 >SB_49546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1214 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 151 SHGVDVTNLPEDHRLNVIIREYLDKY 176 >SB_49303| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0037) Length = 722 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 201 SHGVDVTNLPEDHRLNVIIREYLDKY 226 >SB_47063| Best HMM Match : APOBEC_C (HMM E-Value=0.41) Length = 430 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 221 SHGVDVTNLPEDHRLNVIIREYLDKY 246 >SB_47062| Best HMM Match : APOBEC_C (HMM E-Value=4.5) Length = 249 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 139 SHGVDVTNLPEDHRLNVIIREYLDKY 164 >SB_46566| Best HMM Match : APOBEC_C (HMM E-Value=4.5) Length = 240 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 196 SHGVDVTNLPEDHRLNVIIREYLDKY 221 >SB_45426| Best HMM Match : APOBEC_C (HMM E-Value=4.5) Length = 173 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 79 SHGVDVTNLPEDHRLNVIIREYLDKY 104 >SB_43798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 329 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 240 SHGVDVTNLPEDHRLNVIIREYLDKY 265 >SB_43614| Best HMM Match : APOBEC_C (HMM E-Value=4.5) Length = 168 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 79 SHGVDVTNLPEDHRLNVIIREYLDKY 104 >SB_31068| Best HMM Match : DUF240 (HMM E-Value=2.1) Length = 453 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 205 SHGVDVTNLPEDHRLNVIIREYLDKY 230 >SB_26582| Best HMM Match : APOBEC_C (HMM E-Value=4.5) Length = 189 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 79 SHGVDVTNLPEDHRLNVIIREYLDKY 104 >SB_21916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 45 SHGVDVTNLPEDHRLNVIIREYLDKY 70 >SB_18259| Best HMM Match : APOBEC_C (HMM E-Value=4.5) Length = 81 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 45 SHGVDVTNLPEDHRLNVIIREYLDKY 70 >SB_15817| Best HMM Match : APOBEC_C (HMM E-Value=0.41) Length = 248 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 45 SHGVDVTNLPEDHRLNVIIREYLDKY 70 >SB_6637| Best HMM Match : Phage_integr_N (HMM E-Value=1.4) Length = 397 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 287 SHGVDVTNLPEDHRLNVIIREYLDKY 312 >SB_2753| Best HMM Match : APOBEC_C (HMM E-Value=4.5) Length = 134 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 45 SHGVDVTNLPEDHRLNVIIREYLDKY 70 >SB_1614| Best HMM Match : APOBEC_C (HMM E-Value=4.5) Length = 123 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 79 SHGVDVTNLPEDHRLNVIIREYLDKY 104 >SB_59032| Best HMM Match : APOBEC_C (HMM E-Value=4.5) Length = 123 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 79 SHGVDVTNLPEDHRLNVIIREYLDKY 104 >SB_56361| Best HMM Match : APOBEC_C (HMM E-Value=4.5) Length = 274 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 218 SHGVDVTNLPEDHRLNVIIREYLDKY 243 >SB_46231| Best HMM Match : APOBEC_C (HMM E-Value=4.5) Length = 89 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 45 SHGVDVTNLPEDHRLNVIIREYLDKY 70 >SB_45162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 12 SHGVDVTNLPEDHRLNVIIREYLDKY 37 >SB_44595| Best HMM Match : APOBEC_C (HMM E-Value=4.5) Length = 134 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 45 SHGVDVTNLPEDHRLNVIIREYLDKY 70 >SB_37211| Best HMM Match : APOBEC_C (HMM E-Value=4.5) Length = 301 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 205 SHGVDVTNLPEDHRLNVIIREYLDKY 230 >SB_31191| Best HMM Match : APOBEC_C (HMM E-Value=4.5) Length = 133 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 89 SHGVDVTNLPEDHRLNVIIREYLDKY 114 >SB_18421| Best HMM Match : APOBEC_C (HMM E-Value=4.5) Length = 89 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 45 SHGVDVTNLPEDHRLNVIIREYLDKY 70 >SB_9226| Best HMM Match : APOBEC_C (HMM E-Value=4.5) Length = 262 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 218 SHGVDVTNLPEDHRLNVIIREYLDKY 243 >SB_9027| Best HMM Match : Phage_fiber_2 (HMM E-Value=5.8) Length = 320 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 295 SKGTDITEAFESHHLNSSVNKVLEKY 372 S G D+T E H LN + + L+KY Sbjct: 231 SHGVDVTNLPEDHRLNVIIREYLDKY 256 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,409,143 Number of Sequences: 59808 Number of extensions: 362450 Number of successful extensions: 1012 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 979 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1012 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -