BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10c01r (476 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) 30 1.1 SB_23038| Best HMM Match : EGF_2 (HMM E-Value=2.8e-11) 29 2.6 SB_18894| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_6478| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_43150| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_14825| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_23139| Best HMM Match : Flotillin (HMM E-Value=0.11) 27 6.0 SB_36114| Best HMM Match : Spectrin (HMM E-Value=0.034) 27 6.0 SB_28275| Best HMM Match : REJ (HMM E-Value=0.0012) 27 7.9 SB_3000| Best HMM Match : Extensin_2 (HMM E-Value=0.058) 27 7.9 >SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 347 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +2 Query: 119 VLSLHCSSTLWASDLLTPGGSFASATSMFNVPSEFKIADLLK 244 VLS++C++ L TPG S ++++P EF ADL++ Sbjct: 207 VLSVYCAAVLLKESHYTPGPD-GSNLFIYHLPQEFTDADLMQ 247 >SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) Length = 362 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +2 Query: 119 VLSLHCSSTLWASDLLTPGGSFASATSMFNVPSEFKIADLLK 244 VLS++C++ L TPG S ++++P EF ADL++ Sbjct: 255 VLSVYCAAVLLKESHYTPGPD-GSNLFIYHLPQEFTDADLMQ 295 >SB_23038| Best HMM Match : EGF_2 (HMM E-Value=2.8e-11) Length = 1477 Score = 28.7 bits (61), Expect = 2.6 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -3 Query: 285 YSEDKAFK-KFVLCFFNKSAILNSDGTLNMDVALAKLPPGVNKSEAQSV 142 Y+ D F ++ +S +++ DG+ N+ VA+A LP G + + V Sbjct: 1240 YTNDACFNGSLIIPLAIRSGLMDMDGSENLTVAVADLPQGYQLNSFREV 1288 >SB_18894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 28.3 bits (60), Expect = 3.4 Identities = 20/58 (34%), Positives = 26/58 (44%) Frame = +2 Query: 170 PGGSFASATSMFNVPSEFKIADLLKKQSTNFLKALSSEYCPVFAAFITSVLTPDSLTH 343 PGGS A +T +F V F T+FLK + P FIT+V S+ H Sbjct: 455 PGGSAAEST-VFQVLDAFLGIRHHSPSRTSFLKLMRKHMPPKHNEFITAVENGPSVRH 511 >SB_6478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 621 Score = 27.9 bits (59), Expect = 4.5 Identities = 10/40 (25%), Positives = 22/40 (55%) Frame = -3 Query: 396 NVHLTETQKEKAKQYTSECVKESGVSTEVINAAKTGQYSE 277 N HL E+ ++ +C+K + + ++ ++ KTG+ E Sbjct: 253 NAHLVHADSEQDGIFSDKCIKLAHMHSDAVDFPKTGECPE 292 >SB_43150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 616 Score = 27.9 bits (59), Expect = 4.5 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Frame = -3 Query: 369 EKAKQYTSECVKESGVSTEVINAAKTGQYSEDKAFKKFV-LCFFNKSAILNSDGTLNMDV 193 EK + VK SG++ V +K G+YS +AF + L S +L +D L M Sbjct: 447 EKHDLDLEDAVKTSGIAEIVKTVSKPGKYSRREAFNVAINLVTDPNSIVLLTDLHLEMTS 506 Query: 192 ALAK 181 L K Sbjct: 507 LLLK 510 >SB_14825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 27.9 bits (59), Expect = 4.5 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -3 Query: 333 ESGVSTEVINAAKTGQYSEDK-AFKKFVLCFFNKSAILNSDGTLNMDVALAKLPPG 169 + G + +VI+ K+ + F K++ K A+LN G L +D L +LP G Sbjct: 25 KDGAAQDVIDYIKSDKPDLTVYTFCKYLKTIKRKDAVLNLKGELTVDKHLVELPSG 80 >SB_23139| Best HMM Match : Flotillin (HMM E-Value=0.11) Length = 1166 Score = 27.5 bits (58), Expect = 6.0 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +2 Query: 104 AASCPVLSLHCSSTLWASDLLTPGGSFASATSMFN 208 A+S PVL C W S + PGG F + SM + Sbjct: 1034 ASSIPVLQGGCEQA-WESYAILPGGQFFRSLSMLH 1067 >SB_36114| Best HMM Match : Spectrin (HMM E-Value=0.034) Length = 352 Score = 27.5 bits (58), Expect = 6.0 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -3 Query: 390 HLTETQKEKAKQYTSECVKESGVSTEVINAAKTGQYSEDKA 268 H +T+K+ + + E K S V T+ NAAKTG E A Sbjct: 190 HSPKTRKKFEARLSEEEGKVSHVRTQYENAAKTGMLDEATA 230 >SB_28275| Best HMM Match : REJ (HMM E-Value=0.0012) Length = 1551 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -3 Query: 408 CGADNVHLTETQKEKAKQYTSECVKESGVS 319 C +V +TE+Q ++K + +E K G+S Sbjct: 1110 CSYPSVSITESQANQSKSFPTEYTKAQGIS 1139 >SB_3000| Best HMM Match : Extensin_2 (HMM E-Value=0.058) Length = 1002 Score = 27.1 bits (57), Expect = 7.9 Identities = 27/119 (22%), Positives = 53/119 (44%), Gaps = 3/119 (2%) Frame = -3 Query: 441 VLICLAFAVFNCGADNVHLTETQKEKAKQYTSECVKESGVSTEVINAAKTGQYSEDKAFK 262 +L+ L A C V L+E E+ K+ + +KE ++ T + + K + Sbjct: 632 MLVSLVEAEEKC-IQRVRLSE---EEVKEILQQRIKEEAAPQLSVSVYDTERNEKAKLHR 687 Query: 261 KFVLCFFNKSAILNSDGTLN-MDVALAKL--PPGVNKSEAQSVLEQCKDKTGQDAADKA 94 + + + A+ + L+ + LA++ PP +++ EA + E+C Q DKA Sbjct: 688 QELERKMQEEAMKKHETELDYLAPFLAQIGDPPRISRQEAYKLKEECLQDLKQRLIDKA 746 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,543,972 Number of Sequences: 59808 Number of extensions: 234066 Number of successful extensions: 689 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 672 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 689 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 989515521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -