BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b24f (630 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6869| Best HMM Match : Peptidase_A17 (HMM E-Value=2.8026e-45) 27 9.5 SB_53350| Best HMM Match : MTS (HMM E-Value=0.00021) 27 9.5 >SB_6869| Best HMM Match : Peptidase_A17 (HMM E-Value=2.8026e-45) Length = 811 Score = 27.5 bits (58), Expect = 9.5 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -1 Query: 549 RDSMAHPLITNMYLMTCYVA 490 R+ + HPLI M LMTC V+ Sbjct: 606 REDIEHPLIRKMTLMTCRVS 625 >SB_53350| Best HMM Match : MTS (HMM E-Value=0.00021) Length = 211 Score = 27.5 bits (58), Expect = 9.5 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 378 HFTKLLTELYIELQNFTQIELTLKNTVKFHR 286 H TK TE +E++ Q+ L + KFH+ Sbjct: 165 HITKKATEWGVEMEVLAQLRYDLPKSYKFHK 195 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,902,694 Number of Sequences: 59808 Number of extensions: 354084 Number of successful extensions: 3999 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3926 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3999 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -