BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b23f (580 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 25 0.54 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 6.7 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 8.8 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 8.8 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 8.8 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 25.0 bits (52), Expect = 0.54 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = -3 Query: 305 PPTSHTVKLMFLYSTVSTLKPIVGIVVTISPNLSLYRIVVLPAASKPTINILISFLPK 132 PPTS TV L+ Y + + + +VVTI+ +R V ++ + I LP+ Sbjct: 290 PPTSLTVPLLGKYLLFTMVLVTLSVVVTIAVLNVNFRSPVTHRMARWVRVVFIQVLPR 347 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 Query: 295 DVGGQDKIRPLWRH 336 DV DK+ PL+ H Sbjct: 267 DVSSNDKVHPLYGH 280 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.0 bits (42), Expect = 8.8 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -3 Query: 305 PPTSHTVKLMFLYSTVSTLKPIVGIVVTI 219 PPTS + L+ Y + + V I+VT+ Sbjct: 287 PPTSLVLPLIAKYLLFTFIMNTVSILVTV 315 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 16 ELLGIHWCCVFSLIRDCF 69 EL+ C FSL+RD F Sbjct: 385 ELMQETHVCFFSLLRDAF 402 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.0 bits (42), Expect = 8.8 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -3 Query: 131 RPLNKFANIFPILNYYEYNFQKQSR 57 R L K N+ Y++Y+F + R Sbjct: 26 RNLEKSLNVIHEWKYFDYDFGSEER 50 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,359 Number of Sequences: 438 Number of extensions: 3812 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16748661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -