BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b20r (782 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 24 1.4 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 24 1.4 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 24 1.4 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 24 1.4 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 5.6 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 5.6 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 5.6 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 5.6 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 5.6 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 22 5.6 DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. 22 7.4 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 7.4 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 21 9.8 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 21 9.8 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 21 9.8 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 21 9.8 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 21 9.8 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 21 9.8 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 21 9.8 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 9.8 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 9.8 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 9.8 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 9.8 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 9.8 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 9.8 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 9.8 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 9.8 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 9.8 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 9.8 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 594 KNRQTREHLLVFFT 553 KN QTREH L+ FT Sbjct: 129 KNGQTREHALLAFT 142 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 594 KNRQTREHLLVFFT 553 KN QTREH L+ FT Sbjct: 56 KNGQTREHALLAFT 69 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 594 KNRQTREHLLVFFT 553 KN QTREH L+ FT Sbjct: 72 KNGQTREHALLAFT 85 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 594 KNRQTREHLLVFFT 553 KN QTREH L+ FT Sbjct: 129 KNGQTREHALLAFT 142 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.2 bits (45), Expect = 5.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 412 TVILVWV*SAARKSPL 365 T++LVW SAA SP+ Sbjct: 306 TILLVWAISAAIGSPI 321 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 22.2 bits (45), Expect = 5.6 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -3 Query: 642 ERVGSCHQTRPSCSRRKNRQTRE 574 + S + SCSR +NR+ RE Sbjct: 225 QHTSSRYSRERSCSRDRNREYRE 247 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 22.2 bits (45), Expect = 5.6 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -2 Query: 91 TLPLPRHMP 65 TLPLP+H+P Sbjct: 503 TLPLPQHLP 511 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 22.2 bits (45), Expect = 5.6 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -2 Query: 91 TLPLPRHMP 65 TLPLP+H+P Sbjct: 418 TLPLPQHLP 426 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 5.6 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -2 Query: 91 TLPLPRHMP 65 TLPLP+H+P Sbjct: 737 TLPLPQHLP 745 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 22.2 bits (45), Expect = 5.6 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +3 Query: 561 KQVNALEFVDFSFANKTAEFGDRNPLFLVF 650 + +++ + V++ T GD P+FL F Sbjct: 355 QDISSPDAVEYGIIGPTTCMGDHKPVFLEF 384 >DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. Length = 120 Score = 21.8 bits (44), Expect = 7.4 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -1 Query: 269 CKVTGKCGSVTVRLIPAPRGT 207 C + G CG + + P+GT Sbjct: 75 CPICGACGDIAHTVKYCPKGT 95 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 7.4 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -3 Query: 630 SCHQTRP-SCSRRKNRQTRE 574 S H +R SCSR +NR+ +E Sbjct: 228 SSHYSRERSCSRDRNREYKE 247 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 609 SCSRRKNRQTRE 574 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 609 SCSRRKNRQTRE 574 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 609 SCSRRKNRQTRE 574 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 609 SCSRRKNRQTRE 574 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 609 SCSRRKNRQTRE 574 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 609 SCSRRKNRQTRE 574 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 609 SCSRRKNRQTRE 574 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 609 SCSRRKNRQTRE 574 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 609 SCSRRKNRQTRE 574 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 609 SCSRRKNRQTRE 574 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 609 SCSRRKNRQTRE 574 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.4 bits (43), Expect = 9.8 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -2 Query: 82 LPRHMPTSL 56 LP+H+PTSL Sbjct: 379 LPKHLPTSL 387 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 9.8 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -3 Query: 630 SCHQTRP-SCSRRKNRQTRE 574 S H +R SCSR +NR+ R+ Sbjct: 228 SSHYSRERSCSRDRNREYRK 247 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 9.8 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -3 Query: 630 SCHQTRP-SCSRRKNRQTRE 574 S H +R SCSR +NR+ R+ Sbjct: 228 SSHYSRERSCSRDRNREYRK 247 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 9.8 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -3 Query: 630 SCHQTRP-SCSRRKNRQTRE 574 S H +R SCSR +NR+ R+ Sbjct: 228 SSHYSRERSCSRDRNREYRK 247 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 9.8 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -3 Query: 630 SCHQTRP-SCSRRKNRQTRE 574 S H +R SCSR +NR+ R+ Sbjct: 228 SSHYSRERSCSRDRNREYRK 247 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 9.8 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -3 Query: 630 SCHQTRP-SCSRRKNRQTRE 574 S H +R SCSR +NR+ R+ Sbjct: 217 SSHYSRERSCSRDRNREYRK 236 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,572 Number of Sequences: 438 Number of extensions: 5003 Number of successful extensions: 48 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -