BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b19r (765 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0139 - 20531320-20531433,20532146-20532276,20533031-205333... 31 0.76 03_02_0304 - 7273008-7273257,7273367-7273524,7273668-7273734,727... 30 2.3 10_02_0189 - 6486737-6486916,6486988-6487260,6487364-6487576,648... 29 3.1 07_03_1495 + 26983415-26984797 29 3.1 04_01_0190 - 2234038-2234674,2237128-2237665,2239294-2239378 29 3.1 07_03_0733 + 21062790-21063639,21063674-21063721,21065428-210654... 28 7.1 03_05_0720 + 27114301-27114548,27114647-27114926,27115104-271151... 28 7.1 12_02_0795 + 23217463-23217684,23218296-23219155,23220001-232209... 28 9.4 08_01_1032 + 10447474-10448030,10448784-10449813 28 9.4 01_05_0553 + 23185473-23186188,23187096-23187101,23187230-231873... 28 9.4 >11_06_0139 - 20531320-20531433,20532146-20532276,20533031-20533382, 20533384-20533527,20533726-20533875,20534197-20534204, 20534267-20534471 Length = 367 Score = 31.5 bits (68), Expect = 0.76 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -1 Query: 192 SSVHSWTNTSHYCVRSKTITSTGARHRLWYS 100 S+ H WT Y S T TS G R W+S Sbjct: 111 STGHGWTTREKYVAISHTATSIGVRRARWFS 141 >03_02_0304 - 7273008-7273257,7273367-7273524,7273668-7273734, 7274461-7274645,7274801-7275215,7275311-7275418, 7275557-7275792,7275888-7275914 Length = 481 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 216 GCLGNSAVSSVHSWTNTSHYCVRSKTITSTG 124 GCLGN SV W + + +CV + S G Sbjct: 257 GCLGNKGAVSVRFWLHDTSFCVACCHLASGG 287 >10_02_0189 - 6486737-6486916,6486988-6487260,6487364-6487576, 6489081-6489206 Length = 263 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +3 Query: 156 NSVKYSSSC---VHSKQQSCPGSLRCCCKIECPKHPKH 260 N V++S S +H Q C LR C + CP H H Sbjct: 128 NLVEFSESVGQPIHQLDQLCGQCLRSFCGVSCPNHLVH 165 >07_03_1495 + 26983415-26984797 Length = 460 Score = 29.5 bits (63), Expect = 3.1 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = -2 Query: 392 RVRYAKKVFANEEDAKRTKGKVKYDDPDVERVRRAHLND 276 R + K+VFA EED + +V DD D E +RA N+ Sbjct: 247 RAKLVKRVFAAEEDEEDLSWEV--DDEDEEEQQRAEANE 283 >04_01_0190 - 2234038-2234674,2237128-2237665,2239294-2239378 Length = 419 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = -1 Query: 198 AVSSVHSWTNTSHYCVRSKTITSTGARHRLWYSFHNYCVHGFQSSYTFYNC 46 AV + + N H ++ IT + ARH+ F+ +C+ G + + C Sbjct: 117 AVKKIVNELNVGHKDFFTEVITISEARHKNLVKFYGWCIRGHSWNIIHFMC 167 >07_03_0733 + 21062790-21063639,21063674-21063721,21065428-21065478, 21065559-21065695,21065781-21065997,21066390-21066627, 21066720-21066870,21066990-21067334 Length = 678 Score = 28.3 bits (60), Expect = 7.1 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = -1 Query: 216 GCLGNSAVSSVHSWTNTSHYCVRSKTITSTGARHRLWYSFHNY 88 GC S ++ + SW N Y S T G R WY H + Sbjct: 206 GC--RSCLAGIISWVNDPDYFSGSPTGRVLGVRCNYWYDVHPF 246 >03_05_0720 + 27114301-27114548,27114647-27114926,27115104-27115154, 27115679-27116000,27116610-27116718,27116754-27116802 Length = 352 Score = 28.3 bits (60), Expect = 7.1 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = -1 Query: 750 LGFVHTKFEYTIWSDICKNLFSNVPRVATDHRLSHVPISTQCYYI 616 L ++ F T WS I +L V H+L + IS YY+ Sbjct: 304 LALEYSSFNQTRWSFINTSLLEQARSVVLVHKLMNPSISPSIYYV 348 >12_02_0795 + 23217463-23217684,23218296-23219155,23220001-23220929, 23221184-23221968 Length = 931 Score = 27.9 bits (59), Expect = 9.4 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -2 Query: 356 EDAKRTKGKVKYDDPDVERVRRAHLNDLENIPVFWVLGALYLTTAPE 216 E + + G DPDVE +RR +++P LYL+ PE Sbjct: 478 ERVRNSIGSTLQKDPDVEEMRRILSLSYDDLPQHLKTCLLYLSIFPE 524 >08_01_1032 + 10447474-10448030,10448784-10449813 Length = 528 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -1 Query: 138 ITSTGARHRLWYSFHNYCVHGFQSSYT-FYNCFVAI 34 IT R+W NYC+ +SYT +CF + Sbjct: 260 ITDIAEAKRIWREMSNYCITPDGTSYTLMVSCFAKV 295 >01_05_0553 + 23185473-23186188,23187096-23187101,23187230-23187374, 23187887-23188159,23188275-23188338,23188479-23188744, 23188951-23189045,23189544-23189718,23190669-23191063, 23191830-23191953,23192864-23192959,23193049-23193120, 23194687-23194824,23195369-23195549,23195602-23195963, 23196944-23197386,23197461-23197763,23197857-23198081, 23198260-23198350,23198702-23198779,23198939-23199229, 23199316-23199513,23199681-23200163,23200488-23200562, 23201163-23201324,23201400-23201729,23201816-23201916, 23202477-23202581,23202931-23203162,23203913-23204257, 23204346-23204447,23206010-23206153,23206463-23206551, 23206979-23207061,23207172-23207287,23207824-23207909, 23208461-23208560,23209270-23209335 Length = 2451 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 3/24 (12%) Frame = +3 Query: 54 KMCNYFETHVHSNYERN---TKGD 116 ++CNY ETH H NY N KGD Sbjct: 2172 RICNYCETHRHFNYLYNFLVLKGD 2195 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,179,890 Number of Sequences: 37544 Number of extensions: 450467 Number of successful extensions: 1151 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1151 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2051430072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -