BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b19r (765 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5373| Best HMM Match : Lung_7-TM_R (HMM E-Value=6.6) 33 0.25 SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_34801| Best HMM Match : Vicilin_N (HMM E-Value=0.3) 32 0.44 SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_5103| Best HMM Match : Vicilin_N (HMM E-Value=0.36) 32 0.44 SB_12399| Best HMM Match : DUF885 (HMM E-Value=2.3e-08) 31 1.3 SB_44456| Best HMM Match : PQQ (HMM E-Value=0.73) 30 1.8 SB_2045| Best HMM Match : EGF (HMM E-Value=0) 29 4.1 SB_53269| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_19130| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_17079| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_18954| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.0015) 29 5.4 SB_2740| Best HMM Match : DUF866 (HMM E-Value=1.1) 29 5.4 SB_17433| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_24036| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_14228| Best HMM Match : Zim (HMM E-Value=3.4) 28 7.2 SB_7636| Best HMM Match : zf-CCHC (HMM E-Value=6.6) 28 7.2 SB_52148| Best HMM Match : EGF (HMM E-Value=0) 28 9.5 SB_45442| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_19100| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_8862| Best HMM Match : rve (HMM E-Value=3.3e-12) 28 9.5 SB_4914| Best HMM Match : RVT_1 (HMM E-Value=2.5e-16) 28 9.5 SB_151| Best HMM Match : zf-CCHC (HMM E-Value=8.9e-05) 28 9.5 >SB_5373| Best HMM Match : Lung_7-TM_R (HMM E-Value=6.6) Length = 303 Score = 33.1 bits (72), Expect = 0.25 Identities = 26/72 (36%), Positives = 36/72 (50%), Gaps = 1/72 (1%) Frame = -2 Query: 470 DPAVQSYILYSGILGLKLLAVTILTGRVRYAKKVFANEEDAKRTKGKVKY-DDPDVERVR 294 D AV IL S ILGL L T T V ++KV N+E+ +K KV Y ++ V Sbjct: 208 DRAVNVSILVSEILGLPLPESTTETKTVNTSEKVSNNKENFNSSK-KVSYNENQTVNTSE 266 Query: 293 RAHLNDLENIPV 258 + N+ E + V Sbjct: 267 KVSYNENETVTV 278 >SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 32.3 bits (70), Expect = 0.44 Identities = 20/46 (43%), Positives = 28/46 (60%) Frame = +2 Query: 194 TAELPRQPQVLL*DRVPQAPKTLECSRDRSSERVSLVQRRGHRTSP 331 T +L RQP + R+P A T E SR+ + ++SL+QRRGH P Sbjct: 86 TRQLRRQPSPIR-IRIPAAQSTEETSRNLA--QLSLLQRRGHPPLP 128 >SB_34801| Best HMM Match : Vicilin_N (HMM E-Value=0.3) Length = 451 Score = 32.3 bits (70), Expect = 0.44 Identities = 20/46 (43%), Positives = 28/46 (60%) Frame = +2 Query: 194 TAELPRQPQVLL*DRVPQAPKTLECSRDRSSERVSLVQRRGHRTSP 331 T +L RQP + R+P A T E SR+ + ++SL+QRRGH P Sbjct: 332 TRQLRRQPSPIR-IRIPTAQSTEETSRNLA--QLSLLQRRGHPPLP 374 >SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 32.3 bits (70), Expect = 0.44 Identities = 20/46 (43%), Positives = 28/46 (60%) Frame = +2 Query: 194 TAELPRQPQVLL*DRVPQAPKTLECSRDRSSERVSLVQRRGHRTSP 331 T +L RQP + R+P A T E SR+ + ++SL+QRRGH P Sbjct: 104 TRQLRRQPSPIR-VRIPTAQSTEETSRNLA--QLSLLQRRGHPPLP 146 >SB_5103| Best HMM Match : Vicilin_N (HMM E-Value=0.36) Length = 592 Score = 32.3 bits (70), Expect = 0.44 Identities = 20/46 (43%), Positives = 28/46 (60%) Frame = +2 Query: 194 TAELPRQPQVLL*DRVPQAPKTLECSRDRSSERVSLVQRRGHRTSP 331 T +L RQP + R+P A T E SR+ + ++SL+QRRGH P Sbjct: 436 TRQLRRQPSPIR-VRIPTAQSTEETSRNLA--QLSLLQRRGHPPLP 478 >SB_12399| Best HMM Match : DUF885 (HMM E-Value=2.3e-08) Length = 718 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/65 (26%), Positives = 29/65 (44%), Gaps = 2/65 (3%) Frame = -2 Query: 245 GALYLTTAPEAAW-ATLLFRVYTAGRILHTIVYAVKPLPQPARGIAFGIPFIITVY-MGF 72 GA YL + + T + Y LH + + P P I + +PF++ Y + F Sbjct: 503 GAFYLAPPEDGSRPGTFMVNTYKHEESLHPVPFMFITYPVPLMVITYPVPFMVITYPVPF 562 Query: 71 KVVTH 57 V+T+ Sbjct: 563 MVITY 567 >SB_44456| Best HMM Match : PQQ (HMM E-Value=0.73) Length = 551 Score = 30.3 bits (65), Expect = 1.8 Identities = 20/46 (43%), Positives = 27/46 (58%) Frame = +2 Query: 194 TAELPRQPQVLL*DRVPQAPKTLECSRDRSSERVSLVQRRGHRTSP 331 T +L RQP R+P A T E SR+ + ++SL+QRRGH P Sbjct: 396 TRQLRRQPSPPR-VRIPTAQSTEETSRNLA--QLSLLQRRGHPPLP 438 >SB_2045| Best HMM Match : EGF (HMM E-Value=0) Length = 1101 Score = 29.1 bits (62), Expect = 4.1 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +3 Query: 144 YCVHNSVKYSSSCVHSKQQSCPGSLRCCCK-----IECPKHPKHWN 266 YCV N KY +CV+ G RC CK C P WN Sbjct: 746 YCVTNPCKYQGTCVNEL-----GYYRCLCKEGYNGTNCEIDPCKWN 786 >SB_53269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 472 Score = 28.7 bits (61), Expect = 5.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +3 Query: 15 GRNIPNILLQSSYKMCNYFETHVHSN 92 G N+ +L+ C++F+TH HSN Sbjct: 146 GSNVHAVLVSLIALYCSFFDTHTHSN 171 >SB_19130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 658 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -2 Query: 335 GKVKYDDPDVERVRRAHLN 279 GK+KYDDP E+VR+A N Sbjct: 373 GKMKYDDPLFEKVRQAKEN 391 >SB_17079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2537 Score = 28.7 bits (61), Expect = 5.4 Identities = 20/80 (25%), Positives = 33/80 (41%) Frame = +2 Query: 125 PVEVMVLLRTQ*CEVFVQLCTLETAELPRQPQVLL*DRVPQAPKTLECSRDRSSERVSLV 304 P+++ VL+R Q L+ AEL P L+ ++P P+ +R E Sbjct: 54 PIQLPVLVRNQSAHRLFCSIVLKIAELLAIPVELMAKQLPMGPRGPRATRRPKGEYAERR 113 Query: 305 QRRGHRTSPCPLCASRPLHL 364 ++ G R C R H+ Sbjct: 114 KKEGIREGLCFALGVRGWHV 133 >SB_18954| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.0015) Length = 921 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +3 Query: 141 FYCVHNSVKYSSSCVHSKQQSCPGSLRCCCKIEC 242 +YC + Y+S+ H C G+ +CC EC Sbjct: 209 YYCFECKIGYNSADAHH----CEGTCKCCFSTEC 238 >SB_2740| Best HMM Match : DUF866 (HMM E-Value=1.1) Length = 175 Score = 28.7 bits (61), Expect = 5.4 Identities = 16/68 (23%), Positives = 28/68 (41%), Gaps = 5/68 (7%) Frame = -1 Query: 252 GAWGTLSYNST*GCLGNSAVSS-----VHSWTNTSHYCVRSKTITSTGARHRLWYSFHNY 88 G W ++S GC+ ++ + V + T + C + +RLW + HN Sbjct: 25 GTWQRRGFSSLNGCVTGISIDTGKVLGVEALTVSCKQCKLHDHLDKDSEEYRLWKADHND 84 Query: 87 CVHGFQSS 64 C F+ S Sbjct: 85 CKANFRGS 92 >SB_17433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1924 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/68 (23%), Positives = 28/68 (41%), Gaps = 5/68 (7%) Frame = -1 Query: 252 GAWGTLSYNST*GCLGNSAVSS-----VHSWTNTSHYCVRSKTITSTGARHRLWYSFHNY 88 G W ++S GC+ ++ + V + T + C + +RLW + HN Sbjct: 240 GTWQRRGFSSLNGCVTGISIDTGKVLDVEALTVSCKQCKLHGHLDKDSEEYRLWKADHND 299 Query: 87 CVHGFQSS 64 C F+ S Sbjct: 300 CKANFRGS 307 >SB_24036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2208 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 75 FQSSYTFYNCFVAIYLVCFDL 13 F +YTF CF ++Y+ C DL Sbjct: 661 FTRTYTFETCFSSVYMDCEDL 681 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 75 FQSSYTFYNCFVAIYLVCFDL 13 F +YTF CF ++Y+ C DL Sbjct: 1709 FTRTYTFETCFSSVYMDCEDL 1729 >SB_14228| Best HMM Match : Zim (HMM E-Value=3.4) Length = 406 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 4 IISQVETYQIYCYKAVIKCVTTLKPMYTVIMKGIPKAMPR 123 I+ E +Q Y Y ++ + KP+ T++ K I A PR Sbjct: 211 IVFAAERFQQYIYGKEVEVESDQKPLETILDKPIENASPR 250 >SB_7636| Best HMM Match : zf-CCHC (HMM E-Value=6.6) Length = 349 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/68 (23%), Positives = 28/68 (41%), Gaps = 5/68 (7%) Frame = -1 Query: 252 GAWGTLSYNST*GCLGNSAVSS-----VHSWTNTSHYCVRSKTITSTGARHRLWYSFHNY 88 G W ++S GC+ ++ + V + T + C + +RLW + HN Sbjct: 240 GTWQRRGFSSLNGCVTGISIDTGKVLDVEALTVSCKQCKLHGHLDKDSEEYRLWKADHND 299 Query: 87 CVHGFQSS 64 C F+ S Sbjct: 300 CKANFRGS 307 >SB_52148| Best HMM Match : EGF (HMM E-Value=0) Length = 1055 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = -1 Query: 213 CLGNSAVSSVHSWTNTSHYCVRSKTITSTGARHRLWYSFHNYCVHG 76 CL N ++ V T++++ C + T H + + N C+HG Sbjct: 961 CLSNPCLNGVCVSTSSTYTCRCTVGFKGTRCEHAMNTCYSNPCIHG 1006 >SB_45442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 4 IISQVETYQIYCYKAVIKCVTTLKPMYTVIMKGIPKAMPR 123 I+ E + +Y Y A I +T KP+ ++ K + K PR Sbjct: 650 IVFGCERFNMYTYGADIDVMTDHKPLESIFRKPLHKVPPR 689 >SB_19100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = -1 Query: 150 RSKTITSTGARHRLWYSFHNYCVHGFQSSYTFYNCFVAIYLV 25 RSK + + G R+ Y FHN+ Q+ F YL+ Sbjct: 9 RSKQLIARGCHRRIRYGFHNFSWSKIQNYQFSKQVFSRAYLI 50 >SB_8862| Best HMM Match : rve (HMM E-Value=3.3e-12) Length = 1358 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 4 IISQVETYQIYCYKAVIKCVTTLKPMYTVIMKGIPKAMPR 123 I+ E + +Y Y A I +T KP+ ++ K + K PR Sbjct: 840 IVFGCERFNMYTYGADIDVMTDHKPLESIFRKPLHKVPPR 879 >SB_4914| Best HMM Match : RVT_1 (HMM E-Value=2.5e-16) Length = 548 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 4 IISQVETYQIYCYKAVIKCVTTLKPMYTVIMKGIPKAMPR 123 I+ E + +Y Y A I +T KP+ ++ K + K PR Sbjct: 361 IVFGCERFNMYTYGADIDVMTDHKPLESIFRKPLHKVPPR 400 >SB_151| Best HMM Match : zf-CCHC (HMM E-Value=8.9e-05) Length = 1382 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +2 Query: 236 RVPQAPKTLECSRDRSSERVSLVQ-RRGHRTSPCPLC 343 R+P++ +L SRD +RV ++ R G R CPLC Sbjct: 170 RLPRSKPSLMVSRDDIDQRVEKIRAREGKRV--CPLC 204 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,965,620 Number of Sequences: 59808 Number of extensions: 591478 Number of successful extensions: 1487 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 1321 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1486 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -