BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b19f (597 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0670 - 27128153-27129075,27129152-27129266,27129348-271295... 31 0.92 03_05_1101 - 30408944-30410410 29 2.1 07_03_1394 + 26254438-26254950 28 4.9 06_02_0046 + 10928708-10928798,10929997-10930077,10930567-109306... 28 4.9 03_06_0390 + 33574495-33575976 28 6.5 01_01_0839 - 6540971-6541978,6542076-6542240,6542330-6542419,654... 27 8.6 >04_04_0670 - 27128153-27129075,27129152-27129266,27129348-27129537, 27129652-27129786,27129874-27129971,27131075-27131764 Length = 716 Score = 30.7 bits (66), Expect = 0.92 Identities = 23/104 (22%), Positives = 44/104 (42%) Frame = +2 Query: 212 DAKMLRGGKVKYDDPVVERIRRAHLNDLENIPAFWILGAFYVTTGPAATFATLLFRLFTV 391 D+ L+ K D PV++ + R + +NIP++ + T A ++F Sbjct: 400 DSSKLKNAKKGEDMPVLDELHRNEVFTTDNIPSWLAFSGYLGLTFIAVIAIPMMFHEMKW 459 Query: 392 FRILHTIVYAVIPLPQPSRAIAFGIPYIIMLYMGIQVILYYVTA 523 + ++ I Y + P A G+ I M Y ++ L+ + A Sbjct: 460 YYVV--IAYLLAPALGFCNAYGAGLTDINMAYNYGKIALFILAA 501 >03_05_1101 - 30408944-30410410 Length = 488 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -1 Query: 288 FKWARRILSTTGSSYLTFPPLSIFASSGLANILRVIRASAVR 163 F WA I + G LTF P+ +F + N++ +RA +R Sbjct: 132 FWWATDIAAELGVPRLTFSPVGVFPQLAMNNLV-TVRAEIIR 172 >07_03_1394 + 26254438-26254950 Length = 170 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -1 Query: 444 EG*GNGITA*TMVCRIRNTVNNRKRSVANVAAG 346 +G G+G A VCR+R + R+R VA AAG Sbjct: 26 DGDGDGEEAAAGVCRVRRQLRLRRRVVAAGAAG 58 >06_02_0046 + 10928708-10928798,10929997-10930077,10930567-10930685, 10931275-10931894,10931992-10933184,10933280-10933359, 10933751-10933846,10933931-10934004,10936007-10936151, 10936323-10936487 Length = 887 Score = 28.3 bits (60), Expect = 4.9 Identities = 23/85 (27%), Positives = 35/85 (41%), Gaps = 7/85 (8%) Frame = +1 Query: 295 GEYSRILDTRSVLCDYWTGSNIRNASFPIVYRVPYSAHHRLRCYSITSAFK----SYSFR 462 G + I+ +S C YW + + +P + S+TSA YS Sbjct: 175 GNWKTIMHEQSNQCYYWN-----TVTGETSWEIPNVLASEIAADSVTSASAPTHVDYSME 229 Query: 463 ---HTLHHNAVHGYPSNPVLCHSTV 528 H L HNAV YPS+ + + +V Sbjct: 230 AQAHALTHNAVEAYPSDISVLNGSV 254 >03_06_0390 + 33574495-33575976 Length = 493 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = -1 Query: 288 FKWARRILSTTGSSYLTFPPLSIFASSGLANILRVIRASAVRTVSD 151 F WA + + G LTF P+ +F + N++ +R VR +D Sbjct: 131 FWWATGVAAELGVPRLTFNPVGVFPQLAMNNLV-AVRPDIVRGGAD 175 >01_01_0839 - 6540971-6541978,6542076-6542240,6542330-6542419, 6542536-6542736,6542886-6543098,6543216-6543461 Length = 640 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = +1 Query: 337 DYWTGSNIRNASFPIVY--RVPYSAHHR 414 DY GSN R S+ + Y R P AHHR Sbjct: 408 DYILGSNPRGISYMVGYGARYPRRAHHR 435 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,662,454 Number of Sequences: 37544 Number of extensions: 283899 Number of successful extensions: 666 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 654 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 666 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -