BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b19f (597 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 5.3 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 5.3 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 5.3 S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 21 6.9 EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 21 6.9 DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 21 6.9 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 21 6.9 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 6.9 S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor prot... 21 9.2 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 9.2 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 9.2 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +3 Query: 291 IWRIFPHFGYSERFM*LLDRQQHSQRFFSDCLP 389 IW + + + F+ ++ Q S R F+ C+P Sbjct: 7 IWTLAVNVLFVNSFLFVIAAQDSSGRIFTICVP 39 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +3 Query: 291 IWRIFPHFGYSERFM*LLDRQQHSQRFFSDCLP 389 IW + + + F+ ++ Q S R F+ C+P Sbjct: 7 IWTLAVNVLFVNSFLFVIAAQDSSGRIFTICVP 39 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +3 Query: 291 IWRIFPHFGYSERFM*LLDRQQHSQRFFSDCLP 389 IW + + + F+ ++ Q S R F+ C+P Sbjct: 7 IWTLAVNVLFVNSFLFVIAAQDSSGRIFTICVP 39 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 21.4 bits (43), Expect = 6.9 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +2 Query: 329 FYVTTGPAATFATLLFRLFTVFRILHTIVYAVIPLPQP 442 F++ P+ATF+ L ++ +VF +T AVIP+ P Sbjct: 135 FFIYVHPSATFSLDLNKVVSVF---YT---AVIPMLNP 166 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 481 AVHGYPSNPVLCHSTVKTFSE 543 ++ GYP NP L + K E Sbjct: 113 SLEGYPFNPCLTEAQYKEMEE 133 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 200 ANPEDAKMLRGGKVKYDDPVVERIRRAHLNDLENIP 307 A+P+ ++ K + V+E I++AH +LE P Sbjct: 155 ADPQTYLEIQKXIKKAKEDVIEVIQKAHNMELEPTP 190 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 481 AVHGYPSNPVLCHSTVKTFSE 543 ++ GYP NP L + K E Sbjct: 129 SLEGYPFNPCLTEAQYKEMEE 149 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.4 bits (43), Expect = 6.9 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -3 Query: 427 NNSVNDGVQNTEH 389 NN+ ND +QNT + Sbjct: 416 NNNQNDNIQNTNN 428 >S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor protein. Length = 168 Score = 21.0 bits (42), Expect = 9.2 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +2 Query: 329 FYVTTGPAATFATLLFRLFTVFRILHTIVYAVIPLPQP 442 F++ P+ATF+ L ++ +VF +T AVIP+ P Sbjct: 134 FFIYVQPSATFSLDLNKVVSVF---YT---AVIPMFSP 165 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 493 YPSNPVLCHSTVKTFSEN 546 YP NPVL S+++ S N Sbjct: 177 YPFNPVLFISSLENISLN 194 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 493 YPSNPVLCHSTVKTFSEN 546 YP NPVL S+++ S N Sbjct: 215 YPFNPVLFISSLENISLN 232 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,647 Number of Sequences: 438 Number of extensions: 3195 Number of successful extensions: 14 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -