BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b17r (746 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharo... 26 6.6 SPCC584.11c |||Svf1 family protein Svf1|Schizosaccharomyces pomb... 25 8.7 >SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharomyces pombe|chr 1|||Manual Length = 1616 Score = 25.8 bits (54), Expect = 6.6 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 15 HTCPRIHSGITTYVFNHINIYTASICTTVCVS 110 H + S + TY FN AS+ T +C+S Sbjct: 1274 HLVLELWSDVLTYAFNEEKTIRASLPTLICLS 1305 >SPCC584.11c |||Svf1 family protein Svf1|Schizosaccharomyces pombe|chr 3|||Manual Length = 380 Score = 25.4 bits (53), Expect = 8.7 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -1 Query: 242 RFYVS*NRESVCLLSVHIVKAPFRIDEVLKTTGSLIRL*PRGSIRHTY 99 R S N +S+ ++VH PF+I E +T P S++HT+ Sbjct: 138 RIRASINMDSIIDITVHQDAPPFKIGEDGNSTYGTDPSKPWASMKHTF 185 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,678,161 Number of Sequences: 5004 Number of extensions: 49973 Number of successful extensions: 84 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -