BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b17f (609 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41628| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 37 0.015 SB_41985| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 36 0.034 SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.045 SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 33 0.14 SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 33 0.18 SB_30176| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_32622| Best HMM Match : Ank (HMM E-Value=2.2e-05) 32 0.32 SB_7039| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32 SB_2351| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-07) 32 0.32 SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) 31 0.55 SB_4328| Best HMM Match : Vicilin_N (HMM E-Value=0.39) 31 0.55 SB_14437| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.73 SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.97 SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 31 0.97 SB_49650| Best HMM Match : RVT_1 (HMM E-Value=1.3) 30 1.3 SB_14489| Best HMM Match : DUF789 (HMM E-Value=5.6) 30 1.3 SB_10780| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) 30 1.3 SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) 30 1.3 SB_32934| Best HMM Match : K_tetra (HMM E-Value=7.79963e-42) 30 1.7 SB_6600| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_21540| Best HMM Match : fn3 (HMM E-Value=4.3e-30) 29 3.9 SB_12595| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_37498| Best HMM Match : MATH (HMM E-Value=1.8e-28) 29 3.9 SB_41147| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_79| Best HMM Match : rve (HMM E-Value=1.4e-14) 28 5.1 SB_47038| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_28795| Best HMM Match : AP2 (HMM E-Value=3.9) 28 5.1 SB_22297| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018) 28 5.1 SB_1336| Best HMM Match : zf-C2H2 (HMM E-Value=2.9e-16) 28 5.1 SB_11628| Best HMM Match : DUF1014 (HMM E-Value=0.64) 28 6.8 SB_10513| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_5292| Best HMM Match : GlnE (HMM E-Value=1.7) 28 6.8 SB_57306| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_40832| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_5274| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_37786| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_30220| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_51276| Best HMM Match : rve (HMM E-Value=1.4e-05) 27 9.0 SB_50665| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_46839| Best HMM Match : rve (HMM E-Value=7.3e-11) 27 9.0 SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 27 9.0 SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 27 9.0 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 27 9.0 SB_26138| Best HMM Match : RhoGEF (HMM E-Value=0.0011) 27 9.0 SB_23934| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) 27 9.0 SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) 27 9.0 SB_23259| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 9.0 SB_22842| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_18762| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 >SB_41628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 690 Score = 44.4 bits (100), Expect = 7e-05 Identities = 23/72 (31%), Positives = 38/72 (52%), Gaps = 5/72 (6%) Frame = +1 Query: 400 QLFSEARVINPFRKPVIQRPKLPRRISTSGM----EECEICFSVLPTSIMTGL-ECGHRF 564 ++FS + ++ ++++ K+ I T +EC ICF + MT L CGH F Sbjct: 275 KVFSVSEANEKLQQDLVKQAKIRSGIDTRDWFMVSKECGICFGDFRENKMTALMSCGHSF 334 Query: 565 CTQCWCEYLTTK 600 CT+CW YL ++ Sbjct: 335 CTECWEFYLKSQ 346 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 36.7 bits (81), Expect = 0.015 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 472 RISTSGMEECEICFSVLPTSIMTGLE-CGHRFCTQCWCEYLTTK 600 R+ + C++CFS P S+ CGH FC +C Y T + Sbjct: 112 RVFDTSYFTCDVCFSEKPGSMCLAFHNCGHVFCCECMTGYFTVQ 155 >SB_41985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 472 Score = 36.7 bits (81), Expect = 0.015 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 472 RISTSGMEECEICFSVLPTSIMTGLE-CGHRFCTQCWCEYLTTK 600 R+ + C++CFS P S+ CGH FC +C Y T + Sbjct: 204 RVFDTSYFTCDVCFSEKPGSMCLAFHNCGHVFCCECMTGYFTVQ 247 >SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 35.5 bits (78), Expect = 0.034 Identities = 18/47 (38%), Positives = 22/47 (46%) Frame = +1 Query: 451 QRPKLPRRISTSGMEECEICFSVLPTSIMTGLECGHRFCTQCWCEYL 591 + P+ R +S C IC VL I T C H FC C CE+L Sbjct: 144 EMPETERFVSPPDFVFCAICKEVLTQPIAT--PCDHYFCVLCICEWL 188 >SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.1 bits (77), Expect = 0.045 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 496 ECEICFSVLPTSIMTGLECGHRFCTQCWCEYL 591 +C ICF VL ++T CGH FC+QC ++ Sbjct: 56 KCGICFGVLEDPLVT--TCGHVFCSQCLVHWI 85 >SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 33.5 bits (73), Expect = 0.14 Identities = 17/47 (36%), Positives = 21/47 (44%) Frame = +1 Query: 451 QRPKLPRRISTSGMEECEICFSVLPTSIMTGLECGHRFCTQCWCEYL 591 + P+ R + C IC VL I T C H FC C CE+L Sbjct: 144 EMPETERFVCPPDFVFCAICKEVLTQPIAT--PCDHYFCVLCICEWL 188 >SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 33.5 bits (73), Expect = 0.14 Identities = 17/47 (36%), Positives = 21/47 (44%) Frame = +1 Query: 451 QRPKLPRRISTSGMEECEICFSVLPTSIMTGLECGHRFCTQCWCEYL 591 + P+ R + C IC VL I T C H FC C CE+L Sbjct: 144 EMPETERFVCPPDFVFCAICKEVLTQPIAT--PCDHYFCVLCICEWL 188 >SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 262 Score = 33.1 bits (72), Expect = 0.18 Identities = 17/47 (36%), Positives = 21/47 (44%) Frame = +1 Query: 451 QRPKLPRRISTSGMEECEICFSVLPTSIMTGLECGHRFCTQCWCEYL 591 + P+ R + C IC VL I T C H FC C CE+L Sbjct: 18 EMPETGRFVCPPDFVFCAICKEVLTQPIAT--PCDHYFCVLCICEWL 62 >SB_30176| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1012 Score = 33.1 bits (72), Expect = 0.18 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +1 Query: 508 CFSVLPTSIMTGLE-CGHRFCTQCWCEYLTTK 600 C TGL C H+FC CW +YLT + Sbjct: 365 CLKFEHEDFSTGLLLCSHKFCNSCWHQYLTVQ 396 >SB_32622| Best HMM Match : Ank (HMM E-Value=2.2e-05) Length = 509 Score = 32.3 bits (70), Expect = 0.32 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 493 EECEICFSVLPTS--IMTGLECGHRFCTQCWCEYLTTK 600 E C IC L + + L CGH C CW YL K Sbjct: 204 EPCMICSDDLTGADVLPVALPCGHEACCLCWERYLNVK 241 >SB_7039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 577 Score = 32.3 bits (70), Expect = 0.32 Identities = 17/66 (25%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = +1 Query: 400 QLFSEARVINPFRKPVIQRPKLPRRISTSGMEECEICFSVLPTSIMTGLE-CGHRFCTQC 576 +LF ++ +KP + R+ S C +C++ P S+ + C HR C +C Sbjct: 50 RLFGRSKSYKGEKKP----ESVVRKPSGESCVICPVCYAQRPRSLFPDISTCEHRSCIEC 105 Query: 577 WCEYLT 594 +Y+T Sbjct: 106 LRQYMT 111 >SB_2351| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-07) Length = 137 Score = 32.3 bits (70), Expect = 0.32 Identities = 16/65 (24%), Positives = 28/65 (43%) Frame = +1 Query: 385 DGDQDQLFSEARVINPFRKPVIQRPKLPRRISTSGMEECEICFSVLPTSIMTGLECGHRF 564 + D+D++ +V P K ++P R C +C + + + ECGHR Sbjct: 22 NNDEDKMPEIEKVERPLTKNYFKKPPFEER-----KHLCPVCEDIFVSPVQIK-ECGHRL 75 Query: 565 CTQCW 579 C C+ Sbjct: 76 CQHCY 80 >SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) Length = 471 Score = 31.5 bits (68), Expect = 0.55 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +1 Query: 496 ECEICFSVLPTSIMTGLECGHRFCTQC 576 EC++CF++L + T L CGH FC C Sbjct: 329 ECKLCFNLLLEPV-TSL-CGHSFCRDC 353 >SB_4328| Best HMM Match : Vicilin_N (HMM E-Value=0.39) Length = 738 Score = 31.5 bits (68), Expect = 0.55 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 5/60 (8%) Frame = +1 Query: 145 NESSGDDVDFAMDVETHSTRERQT----ELEEYPYEVLST-EEIVQHMVDCIKEVNTVVE 309 +E S +DV ++ VE H +++ E++ P E+ + EE VQH + I+E TV+E Sbjct: 293 DEPSDEDVTESLRVEDHEKYSKKSLASYEIDLSPDELFAIHEEGVQHKISSIREKMTVIE 352 >SB_14437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 31.1 bits (67), Expect = 0.73 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +1 Query: 154 SGDDVDFAMDVETHSTRERQTELEEYPYEVLSTEEIVQHMVDCIKEVNT 300 SGDD+ + +HST E + EL+ E +E+++H + + V T Sbjct: 155 SGDDLPHGLRSTSHSTEELRMELKLLDSEEKHLDELIEHAREELTSVKT 203 >SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1442 Score = 30.7 bits (66), Expect = 0.97 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +1 Query: 496 ECEICFSVLPTSIM-TGLECGHRFCTQCWCEYL 591 EC +C + P + M T L C RFC+ C +Y+ Sbjct: 1004 ECIVCMDLKPENRMITMLNCQCRFCSDCVSQYV 1036 >SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 346 Score = 30.7 bits (66), Expect = 0.97 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 499 CEICFSVLPTSIMTGLECGHRFCTQC 576 C IC VL +I T CGH FC C Sbjct: 18 CNICVGVLENAITT--ICGHSFCESC 41 >SB_49650| Best HMM Match : RVT_1 (HMM E-Value=1.3) Length = 379 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = -1 Query: 270 MLDNLLCRQNLVRILLKLSLSFPC---TMSFNVHCKVDIVSTRL 148 +L+ LLC + I+LKL + F C T F CK+ + + RL Sbjct: 15 LLEGLLCHSTVGSIILKLFVVFLCFRNTAVFRSSCKLPVTNFRL 58 >SB_14489| Best HMM Match : DUF789 (HMM E-Value=5.6) Length = 382 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +2 Query: 134 WTRVMSLVETMSTLQWTLKLIVQGKDKLSLRSILTRFCLQRRLSN 268 W R + +V S +T+ ++ G+ SLR L + C++ LSN Sbjct: 27 WNRQLIIVVRESVTSFTVTTVLPGERHESLRDALAKSCIELCLSN 71 >SB_10780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +1 Query: 448 IQRPKLPRRISTSGMEECEICFSVLPTSIMTGLECGHRFC 567 IQ P+ PR S +C +C + +T CGH FC Sbjct: 85 IQAPEPPRAFSND--RQCPVC--ITDARFLTMTNCGHEFC 120 >SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) Length = 380 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +1 Query: 475 ISTSGMEECEICFSVLPTSIMTGLECGHRFCTQC 576 +S+ EEC IC L +T C H FCT C Sbjct: 57 LSSGVSEECPICLDPLDDPSIT--RCAHVFCTGC 88 >SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) Length = 306 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 499 CEICFSVLPTSIMTGLECGHRFCTQCWCEYLTTK 600 C IC VL +++T CGH FC C ++ K Sbjct: 18 CGICAEVLERAVLT--PCGHSFCGVCLETWMNAK 49 >SB_32934| Best HMM Match : K_tetra (HMM E-Value=7.79963e-42) Length = 1207 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 3/34 (8%) Frame = +1 Query: 499 CEICFSVLPTSI--MTGLE-CGHRFCTQCWCEYL 591 C +C+ + SI + L C H FC +CW YL Sbjct: 654 CRVCYEMATFSIEGFSVLNACSHWFCDECWQAYL 687 >SB_6600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 29.9 bits (64), Expect = 1.7 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 1/88 (1%) Frame = +1 Query: 163 DVDFAMDVETHSTRERQTELEEYPYEVLSTEEI-VQHMVDCIKEVNTVVEIPATTTRILL 339 +V+ M+VET E + E+E EV + +E+ + V+ KEV T E+ T + + Sbjct: 14 EVETEMEVETEMEVETEKEVET-EKEVETEKEVETEKEVETEKEVETKKEV--ETEKEVE 70 Query: 340 NHFKWDKEKLMERFYDGDQDQLFSEARV 423 KW +E +R G + ++ +E V Sbjct: 71 GSRKWRREGSGDRERSGGEKEVETEKEV 98 >SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 496 ECEICFSVLPTSIMTGLECGHRFCTQC 576 EC IC I ECGHRFC C Sbjct: 25 ECPICQLAFRDPIQIE-ECGHRFCQSC 50 >SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 496 ECEICFSVLPTSIMTGLECGHRFCTQCWCEYLTTK 600 EC IC ++++ CGH FC C +L T+ Sbjct: 62 ECNICLDTARDAVIS--MCGHLFCWPCLHRWLETR 94 >SB_21540| Best HMM Match : fn3 (HMM E-Value=4.3e-30) Length = 634 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -1 Query: 300 SVHFFNAVNHMLDNLLCRQNLVRILLKLSLSFPCTMSFNVHCKV 169 SV F N ++ L +R+ LS S C+++F V CK+ Sbjct: 166 SVLFANGIHQKCRKRLKYAECLRVYAPLSYSVTCSLTFLVFCKI 209 >SB_12595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.7 bits (61), Expect = 3.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 499 CEICFSVLPTSIMTGLECGHRFCTQC 576 C C +L ++ T +CGHR+C C Sbjct: 61 CSKCGFILKDAVQT--DCGHRYCLSC 84 >SB_37498| Best HMM Match : MATH (HMM E-Value=1.8e-28) Length = 562 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 499 CEICFSVLPTSIMTGLECGHRFCTQCW 579 C IC VL + T CGHR C C+ Sbjct: 34 CTICKHVLQEPLQT--TCGHRICESCF 58 >SB_41147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 332 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 496 ECEICFSVLPTSIMTGLECGHRFCTQC 576 +C IC + T +CGHRFC C Sbjct: 41 QCPICQLPFRDPVQTR-DCGHRFCESC 66 >SB_79| Best HMM Match : rve (HMM E-Value=1.4e-14) Length = 271 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/63 (22%), Positives = 33/63 (52%) Frame = +2 Query: 65 HYKSYKFS*SLQRWIRKMTRKTMWTRVMSLVETMSTLQWTLKLIVQGKDKLSLRSILTRF 244 H++S F+ S+ RW+ + + +++ ++ ET +W L + D + ++ +T F Sbjct: 168 HHRSQAFAESVHRWLAQRLFRAQYSKELASGET--NREWVTALPIVISDIKATKTRMTGF 225 Query: 245 CLQ 253 L+ Sbjct: 226 ALE 228 >SB_47038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 876 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/60 (23%), Positives = 31/60 (51%) Frame = +2 Query: 65 HYKSYKFS*SLQRWIRKMTRKTMWTRVMSLVETMSTLQWTLKLIVQGKDKLSLRSILTRF 244 H++S F+ S RW+ + + +++ ++ ET +W L + DK + ++ +T F Sbjct: 747 HHRSQAFAESFHRWLAQRLFRARYSKELASGET--NREWVTALPIGVSDKNATKTRMTGF 804 >SB_28795| Best HMM Match : AP2 (HMM E-Value=3.9) Length = 375 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/60 (23%), Positives = 31/60 (51%) Frame = +2 Query: 65 HYKSYKFS*SLQRWIRKMTRKTMWTRVMSLVETMSTLQWTLKLIVQGKDKLSLRSILTRF 244 H++S F+ S RW+ + + +++ ++ ET +W L + DK + ++ +T F Sbjct: 296 HHRSQAFAESFHRWLAQRLFRARYSKELASGET--NREWVTALPIGVSDKNATKTRMTGF 353 >SB_22297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/63 (22%), Positives = 33/63 (52%) Frame = +2 Query: 65 HYKSYKFS*SLQRWIRKMTRKTMWTRVMSLVETMSTLQWTLKLIVQGKDKLSLRSILTRF 244 H++S F+ S+ RW+ + + +++ ++ ET +W L + D + ++ +T F Sbjct: 168 HHRSQAFAESVHRWLAQRLFRAQYSKELASGET--NREWVTALPIVISDIKATKTRMTGF 225 Query: 245 CLQ 253 L+ Sbjct: 226 ALE 228 >SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018) Length = 843 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 4/30 (13%) Frame = +1 Query: 499 CEICFSVL----PTSIMTGLECGHRFCTQC 576 C +C++ P I L+C H FCT+C Sbjct: 330 CPLCYTAYGTGYPQRIPRILDCSHTFCTEC 359 >SB_1336| Best HMM Match : zf-C2H2 (HMM E-Value=2.9e-16) Length = 298 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/59 (30%), Positives = 32/59 (54%) Frame = +1 Query: 148 ESSGDDVDFAMDVETHSTRERQTELEEYPYEVLSTEEIVQHMVDCIKEVNTVVEIPATT 324 E+S D + ++D T S R RQ L+ E+LS++E QH + + + +++ TT Sbjct: 54 ENSIFDSESSIDSITSSLR-RQISLQITNNEILSSDERAQHQTENMVPSSQALDVEMTT 111 >SB_11628| Best HMM Match : DUF1014 (HMM E-Value=0.64) Length = 423 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 518 TEKHISHSSIPDVDILLGSFGLCMTGFLNG 429 TEK++S S IL S+GL + FLNG Sbjct: 386 TEKNVSPSGATSQSILRYSYGLDIARFLNG 415 >SB_10513| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = +2 Query: 134 WTRVMSLVETMSTLQWTLKLIVQGKDKLSLRSILTRFCLQRR 259 W+R L+ +T L++ + +LR L R C+Q R Sbjct: 237 WSRQFILIVRECVTSYTTSLLLTNEQHSTLRDALIRLCVQMR 278 >SB_5292| Best HMM Match : GlnE (HMM E-Value=1.7) Length = 325 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +3 Query: 465 SQEDINVWYGRM*NMFLSFTNLYYDWVGMWSQILHAMLV*IFNYEIME 608 ++EDI YG L+FT ++ G+ +H +L + YE+ E Sbjct: 223 AEEDITQQYGINQRSILNFTRYFHVVGGLPGDTMHDVLEGLLQYEVKE 270 >SB_57306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 27.9 bits (59), Expect = 6.8 Identities = 24/79 (30%), Positives = 35/79 (44%) Frame = +2 Query: 71 KSYKFS*SLQRWIRKMTRKTMWTRVMSLVETMSTLQWTLKLIVQGKDKLSLRSILTRFCL 250 + Y S L R +RK ++ TR T S L TL+ K + RS+LTR Sbjct: 55 RKYYTSSLLTRTLRKYNTSSLLTRTSRKYNTSSLLTRTLR-------KYNTRSLLTRTLR 107 Query: 251 QRRLSNIWLTALKK*TLSS 307 + S++ L+K SS Sbjct: 108 KYNTSSLLTRTLRKYNTSS 126 >SB_40832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1496 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +1 Query: 394 QDQLFSEARVINPFRKPVIQRPKLPRRI 477 +D + S+ +VI P KP I+RP PR I Sbjct: 36 KDHISSQVKVIEP-SKPTIERPVAPRDI 62 >SB_5274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/53 (22%), Positives = 29/53 (54%) Frame = +1 Query: 280 CIKEVNTVVEIPATTTRILLNHFKWDKEKLMERFYDGDQDQLFSEARVINPFR 438 C+K + ++ +P + R+L KE+L+ + +++L S+ R+++ R Sbjct: 113 CLKNSSYLINVPISEVRLLSKERLLSKERLLSKVRLLSKERLLSKERLLSKER 165 >SB_37786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 499 CEICFSVLPTSIMTGLECGHRFCTQCW 579 C IC VL + + +C H C+ CW Sbjct: 172 CAICLDVLEKPLSS--KCQHSCCSDCW 196 >SB_30220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 27.5 bits (58), Expect = 9.0 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +1 Query: 550 CGHRFCTQCWCEYLTT 597 CGHR CT+C+ + L++ Sbjct: 447 CGHRVCTKCYTKLLSS 462 >SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1094 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 499 CEICFSVLPTSIMTGLECGHRFCTQCW 579 C C V ++TG CGH CT+C+ Sbjct: 18 CSYCRKVYLHPLVTG--CGHVLCTKCY 42 >SB_51276| Best HMM Match : rve (HMM E-Value=1.4e-05) Length = 324 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/60 (23%), Positives = 30/60 (50%) Frame = +2 Query: 65 HYKSYKFS*SLQRWIRKMTRKTMWTRVMSLVETMSTLQWTLKLIVQGKDKLSLRSILTRF 244 H++S F+ S RW+ K + +++ ++ ET +W L + D + ++ +T F Sbjct: 208 HHRSQAFAVSFHRWLAKRLFRAQYSKELASGET--NREWVTALPIVISDINATKTCMTGF 265 >SB_50665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 499 CEICFSVLPTSIMTGLECGHRFCTQCW 579 C IC VL + + +C H C+ CW Sbjct: 168 CAICLDVLEKPLSS--KCQHSCCSDCW 192 >SB_46839| Best HMM Match : rve (HMM E-Value=7.3e-11) Length = 565 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/60 (23%), Positives = 31/60 (51%) Frame = +2 Query: 65 HYKSYKFS*SLQRWIRKMTRKTMWTRVMSLVETMSTLQWTLKLIVQGKDKLSLRSILTRF 244 H++S F+ S RW+ + + +++ ++ ET L+W L + D + ++ +T F Sbjct: 225 HHRSQTFAESFHRWLAQRLFRVQYSKELASGET--NLEWVTALPIVISDINATKTRMTGF 282 >SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 499 CEICFSVLPTSIMTGLECGHRFCTQCW 579 C IC VL + + +C H C+ CW Sbjct: 76 CAICLDVLEKPLSS--KCQHSCCSDCW 100 >SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) Length = 846 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 499 CEICFSVLPTSIMTGLECGHRFCTQCW 579 C IC VL + + +C H C+ CW Sbjct: 316 CAICLDVLEKPLSS--KCQHSCCSDCW 340 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 499 CEICFSVLPTSIMTGLECGHRFCTQCW 579 C IC VL + + +C H C+ CW Sbjct: 642 CAICLDVLEKPLSS--KCQHSCCSDCW 666 >SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 7381 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 343 HFKWDKEKLMERFYDGDQDQLFSEARVINPFRKPVIQR 456 H+ DK+K + Y+G++DQ + INP P++ R Sbjct: 2149 HWTMDKKKNSWKLYNGNRDQYSTVTESINP---PILAR 2183 >SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) Length = 398 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = +1 Query: 493 EECEICFSVLPTSIMTGL-ECGHRFCTQC---WCEYLTT 597 + C IC T L CGH++C C W E TT Sbjct: 260 KSCPICLEEFTPETPTRLLVCGHKYCEPCLSRWLENNTT 298 >SB_26138| Best HMM Match : RhoGEF (HMM E-Value=0.0011) Length = 1199 Score = 27.5 bits (58), Expect = 9.0 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -1 Query: 453 LYDRFPEWIDNSSFRE 406 +YDR PE++DN FR+ Sbjct: 138 VYDRSPEYVDNHEFRD 153 >SB_23934| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) Length = 617 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/28 (42%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 496 ECEICFSVL-PTSIMTGLECGHRFCTQC 576 EC IC P + GL CGH F C Sbjct: 559 ECVICLDEFKPGCTLLGLPCGHSFHQHC 586 >SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) Length = 418 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 499 CEICFSVLPTSIMTGLECGHRFCTQCW 579 C IC VL + + +C H C+ CW Sbjct: 174 CAICLDVLEKPLSS--KCQHSCCSDCW 198 >SB_23259| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1449 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 439 KPVIQRPKLPRRISTSGMEECEIC 510 KPV ++P+ P +S G +C IC Sbjct: 1094 KPVPEKPQPPMALSGHGSTQCNIC 1117 >SB_22842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 757 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 499 CEICFSVLPTSIMTGLECGHRFCTQCW 579 C IC VL + + +C H C+ CW Sbjct: 319 CAICLDVLEKPLSS--KCQHSCCSDCW 343 >SB_18762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 499 CEICFSVLPTSIMTGLECGHRFCTQCW 579 C IC VL + + +C H C+ CW Sbjct: 25 CAICLDVLEKPLSS--KCQHSCCSDCW 49 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,082,279 Number of Sequences: 59808 Number of extensions: 409438 Number of successful extensions: 1296 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 1202 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1296 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -