BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b16f (647 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_1025 - 10506144-10506226,10506643-10506699,10507502-105076... 32 0.45 11_01_0419 + 3226224-3226756,3228010-3228169,3228256-3228435,322... 29 2.4 01_06_0006 - 25517892-25517935,25518156-25518276,25518598-255187... 29 2.4 06_02_0019 - 10656005-10657511,10657712-10658739 29 3.2 03_02_0186 - 6243487-6243799,6243892-6244400,6244495-6244557,624... 29 4.2 02_03_0412 - 18749430-18749587,18749696-18749857,18750062-187501... 29 4.2 11_01_0110 + 850780-850805,851465-851537,851558-851720,851947-85... 28 5.6 10_08_0188 - 15596062-15597084,15597513-15597791 27 9.7 03_02_0882 - 12121917-12124446,12124739-12124919,12125057-121251... 27 9.7 >12_01_1025 - 10506144-10506226,10506643-10506699,10507502-10507605, 10507884-10507937,10508107-10508193,10509027-10509214, 10509793-10509854,10510084-10510354,10510756-10510834, 10511715-10511913,10512816-10512960,10513324-10513416, 10514449-10514736 Length = 569 Score = 31.9 bits (69), Expect = 0.45 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +1 Query: 388 ETFYKTACFARVHLNQGQFLYAF-YIAVIQRSDCHGF 495 ETF+ TAC R HL QG+ + A+ Y+ + DC GF Sbjct: 427 ETFFTTACMGRGHLCQGKLVDAYRYLHKEKDMDC-GF 462 >11_01_0419 + 3226224-3226756,3228010-3228169,3228256-3228435, 3228525-3228659,3229262-3229344,3229442-3229535, 3229649-3229735 Length = 423 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = -3 Query: 540 IHKHFRVYFIRSRNNETVAIRALDNSDVEGIQELTLIEMHT 418 IHK FR++ R + E +AIRA NS + L L +M T Sbjct: 319 IHKPFRIHLGRGLHGECLAIRADGNSKLSHEIGLELSKMST 359 >01_06_0006 - 25517892-25517935,25518156-25518276,25518598-25518733, 25519189-25519280,25519358-25519426,25519710-25519821, 25519897-25520015,25520302-25520355,25520811-25520891, 25520968-25521051,25521124-25521315,25521633-25521746, 25521832-25521978,25522066-25522302,25522762-25522810, 25522894-25523027,25523124-25523324,25523532-25523701, 25523773-25523875,25524198-25524361,25525015-25525055, 25525144-25525187 Length = 835 Score = 29.5 bits (63), Expect = 2.4 Identities = 24/91 (26%), Positives = 40/91 (43%), Gaps = 11/91 (12%) Frame = +1 Query: 112 VDAVFVEKQKKILSFFQDVSQLNTDDEYYK-------IGKDYDIEMNMDNYTNKKAVEEF 270 VD V+ Q+K + ++ ++ ++ Y+ I K E + Y NK +EF Sbjct: 651 VDRVYRIGQEKNVIIYRLITSCTIEERIYEKQVSKEGIFKAATEERDFRRYINKLGYKEF 710 Query: 271 LKMYRTGF----MPKNLEFSVFYDKMRDEAI 351 LK+ GF + K LE D M + A+ Sbjct: 711 LKLPEMGFGTSLLQKRLEIETMTDNMSELAV 741 >06_02_0019 - 10656005-10657511,10657712-10658739 Length = 844 Score = 29.1 bits (62), Expect = 3.2 Identities = 10/32 (31%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -1 Query: 551 STSIFINILGY-TSYGAGTTKPWQSERWITAM 459 +T+I ++++G +YGAG+++ W++ ++ AM Sbjct: 750 NTTIVLDMIGLLVAYGAGSSREWETSGYVIAM 781 >03_02_0186 - 6243487-6243799,6243892-6244400,6244495-6244557, 6245482-6245681,6246125-6246519,6246776-6246888 Length = 530 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 405 CLFCACASQSRSILVCLLHRCYPA 476 CLFC SR ILVC L RC A Sbjct: 58 CLFCEANFISRRILVCDLLRCLVA 81 >02_03_0412 - 18749430-18749587,18749696-18749857,18750062-18750194, 18751640-18751744,18751818-18751935,18752232-18752320, 18752407-18753660,18753785-18753831,18754285-18754339, 18754783-18754884 Length = 740 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = -3 Query: 606 CGFRINEAILHLCYVNFLQHFHIHKHFRVYFI-RSRNNETVAIRAL-DNSDVE 454 C I+ L+ Y+ +QHFH+ + + RS+N+ T +I+ L D S ++ Sbjct: 278 CFMMISTKELYTIYITQVQHFHVGDNVTFTLLSRSKNSLTPSIKNLTDESTID 330 >11_01_0110 + 850780-850805,851465-851537,851558-851720,851947-852260, 852330-852409,852506-852848,853068-853166,853240-853360, 853567-853723,853976-854099,855275-855368,855866-857259, 857882-857924,858240-858458,859379-859605,859701-859948, 860246-860552,860725-861153 Length = 1486 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 612 LSCGFRINEAILHLCYVNFLQHFHIHKHFRVYFIR 508 L GFR++ A+ +LC + +L+ I K R IR Sbjct: 1002 LKAGFRLSSALFYLCNILWLRAVKIRKKLRRQGIR 1036 >10_08_0188 - 15596062-15597084,15597513-15597791 Length = 433 Score = 27.5 bits (58), Expect = 9.7 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 48 WACSRRAQQCSTKAEHHKDKKCG 116 W C RR +Q ++ ++H D+K G Sbjct: 206 WHCQRRVRQPNSLCDYHSDQKRG 228 >03_02_0882 - 12121917-12124446,12124739-12124919,12125057-12125134, 12125731-12125764,12125864-12125975,12126053-12126238, 12126505-12126575 Length = 1063 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 127 VEKQKKILSFFQDVSQLNTDDEY 195 VE+Q SF QD++QL DD Y Sbjct: 143 VEQQVNCFSFLQDLNQLYADDLY 165 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,927,564 Number of Sequences: 37544 Number of extensions: 307050 Number of successful extensions: 712 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 712 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -