BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b15r (710 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 27 0.77 AY146740-1|AAO12100.1| 139|Anopheles gambiae odorant-binding pr... 23 7.2 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 7.2 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 23 9.5 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 23 9.5 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 26.6 bits (56), Expect = 0.77 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -1 Query: 263 IPFTIQTKSIKVENLPVIDTAYPTW*KNNI*KDKQV 156 I FT+ + I +E+LPV+D P W KD +V Sbjct: 1756 IEFTLPSPKIGIESLPVVD---PPWMPRQQNKDMEV 1788 >AY146740-1|AAO12100.1| 139|Anopheles gambiae odorant-binding protein AgamOBP9 protein. Length = 139 Score = 23.4 bits (48), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 64 CCINKIDYLLDTQMYVVENIIIKL 135 C NK+ DT +V+N++++L Sbjct: 65 CIFNKMQLFDDTNGPIVDNLVVQL 88 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.4 bits (48), Expect = 7.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -1 Query: 686 ITFLVNKGITQLNEYPEQVELLRKIWFTKYARHWT 582 IT V+ + ++ E P VE ++ W T + WT Sbjct: 838 ITTGVSSKLARIAERPYSVEAWQREWSTTTSGSWT 872 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 23.0 bits (47), Expect = 9.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 472 ITKPTTWVTSTSW 434 I +P TWV STS+ Sbjct: 194 IARPDTWVVSTSY 206 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -2 Query: 292 TDLADCASTTYPSLSKQNRSKSKTYR 215 T++A C S + K NR+KS R Sbjct: 276 TEIAQCRSHCIEARRKMNRAKSSEQR 301 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 713,076 Number of Sequences: 2352 Number of extensions: 14487 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72758970 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -