BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b15f (633 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g49040.2 68414.m05499 stomatal cytokinesis defective / SCD1 p... 32 0.36 At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 p... 32 0.36 At1g62950.1 68414.m07108 leucine-rich repeat transmembrane prote... 30 1.1 At5g17000.1 68418.m01991 NADP-dependent oxidoreductase, putative... 29 1.9 At4g28480.1 68417.m04074 DNAJ heat shock family protein contains... 29 1.9 At5g61480.1 68418.m07714 leucine-rich repeat transmembrane prote... 29 2.6 At4g35380.1 68417.m05026 guanine nucleotide exchange family prot... 29 3.4 At4g14160.2 68417.m02186 transport protein, putative similar to ... 29 3.4 At1g12460.1 68414.m01440 leucine-rich repeat transmembrane prote... 29 3.4 At5g15450.1 68418.m01808 heat shock protein 100, putative / HSP1... 28 5.9 At3g01290.1 68416.m00037 band 7 family protein similar to hypers... 28 5.9 At5g60090.1 68418.m07534 protein kinase family protein contains ... 27 7.8 At5g43935.1 68418.m05375 flavonol synthase, putative similar to ... 27 7.8 At2g16140.1 68415.m01850 expressed protein contains similarity t... 27 7.8 At1g69780.1 68414.m08029 homeobox-leucine zipper protein 13 (HB-... 27 7.8 At1g68400.1 68414.m07814 leucine-rich repeat transmembrane prote... 27 7.8 At1g12550.1 68414.m01455 oxidoreductase family protein similar t... 27 7.8 >At1g49040.2 68414.m05499 stomatal cytokinesis defective / SCD1 protein (SCD1) contains Pfam PF02141: DENN (AEX-3) domain; contains Pfam PF00400: WD domain, G-beta repeat (8 copies); identical to stomatal cytokinesis defective [Arabidopsis thaliana] GI:19743728; supporting cDNA gi|19743727|gb|AY082605.1|; PMID 12874123 Length = 909 Score = 31.9 bits (69), Expect = 0.36 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +1 Query: 280 DSTTDDDLLRVSEEMFNADINNAFNYIQVNL 372 D +T D L VS EMF D NN +Y+Q +L Sbjct: 633 DLSTVRDALEVSAEMFKKDANNVSDYVQRHL 663 >At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 protein (SCD1) contains Pfam PF02141: DENN (AEX-3) domain; contains Pfam PF00400: WD domain, G-beta repeat (8 copies); identical to stomatal cytokinesis defective [Arabidopsis thaliana] GI:19743728; supporting cDNA gi|19743727|gb|AY082605.1|; PMID 12874123 Length = 1187 Score = 31.9 bits (69), Expect = 0.36 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +1 Query: 280 DSTTDDDLLRVSEEMFNADINNAFNYIQVNL 372 D +T D L VS EMF D NN +Y+Q +L Sbjct: 633 DLSTVRDALEVSAEMFKKDANNVSDYVQRHL 663 >At1g62950.1 68414.m07108 leucine-rich repeat transmembrane protein kinase, putative contains protein kinase domains Length = 890 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +1 Query: 259 DLLRQAQDSTTDDDLLRVSEEMFNADINNAFNYIQVNLQG 378 ++L Q +D+ DD ++ + NAD+ N+FN + N +G Sbjct: 34 EILLQFKDNINDDPYNSLASWVSNADLCNSFNGVSCNQEG 73 >At5g17000.1 68418.m01991 NADP-dependent oxidoreductase, putative strong similarity to probable NADP-dependent oxidoreductase (zeta-crystallin homolog) P1 [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430], Arabidopsis thaliana Length = 345 Score = 29.5 bits (63), Expect = 1.9 Identities = 32/154 (20%), Positives = 65/154 (42%), Gaps = 1/154 (0%) Frame = +1 Query: 109 AAGQIFNNILPNLISNHVTGQQGNTAQNTFQQIGTVVGGVVDYAKKKSYEDLLRQAQDST 288 A GQ+ ++ +V G G+T + + +Y ++ L++ + Sbjct: 167 AVGQLVGQFA-KMMGCYVVGSAGSTEKVDLLKTKFGFDDAFNYKEEPDLSAALKRCFPTG 225 Query: 289 TDDDLLRVSEEMFNADINNAFNYIQVNLQGKTTPMS-RNDEAQSNLLNVPENVWSGPTIR 465 D V +M +A + N + ++ + G + + N E NL N+ ++ I+ Sbjct: 226 IDIYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYNLENQEGVHNLSNI---IYKRIRIQ 282 Query: 466 PFVALFDNYHKNVIRPEFVTPNEETEQTTYINTI 567 F A+FD Y K +FV P+ + + TY+ + Sbjct: 283 GF-AVFDFYEKYSKFLDFVLPHIKEGKITYVEDV 315 >At4g28480.1 68417.m04074 DNAJ heat shock family protein contains Pfam profile PF00226: DnaJ domain; ; similar to DnaJ homolog subfamily B member 1 (Heat shock 40 kDa protein 1) (Heat shock protein 40) (HSP40) (DnaJ protein homolog 1) (HDJ-1) (Swiss-Prot:P25685) [Homo sapiens] and (Swiss-Prot:Q9QYJ3) [Mus musculus] Length = 348 Score = 29.5 bits (63), Expect = 1.9 Identities = 20/89 (22%), Positives = 40/89 (44%), Gaps = 1/89 (1%) Frame = +1 Query: 301 LLRVSEEMFNADINNAFNYIQVNLQGKTTPMSRND-EAQSNLLNVPENVWSGPTIRPFVA 477 +L+V + D+ A+ + + P ++ D EA+ ++ +V S P R A Sbjct: 8 VLQVDRSANDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEAYDVLSDPQKR---A 64 Query: 478 LFDNYHKNVIRPEFVTPNEETEQTTYINT 564 ++D Y + ++ PN T +Y +T Sbjct: 65 VYDQYGEEGLKGNVPPPNAATSGASYFST 93 >At5g61480.1 68418.m07714 leucine-rich repeat transmembrane protein kinase, putative Length = 1041 Score = 29.1 bits (62), Expect = 2.6 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = +1 Query: 340 NNAFNYIQVNLQGKTTPMSRNDEAQSNLLN--VPENVWSGPTIRPFVALFDN 489 NN F Q+ T P+ + +N + +PEN+W P ++ F A F N Sbjct: 450 NNRFTD-QIPADFATAPVLQYLNLSTNFFHRKLPENIWKAPNLQIFSASFSN 500 >At4g35380.1 68417.m05026 guanine nucleotide exchange family protein similar to guanine nucleotide exchange factor [Homo sapiens] GI:5456754; contains Pfam profile PF01369: Sec7 domain Length = 1706 Score = 28.7 bits (61), Expect = 3.4 Identities = 19/105 (18%), Positives = 46/105 (43%), Gaps = 2/105 (1%) Frame = -1 Query: 366 HLNVVEGIIYICIKHFLANSEEVIVGRRI--LCLAQQIFVALLLRIVNDATDNCAYLLES 193 H++++ I H + + ++ R+ C Q + LL N+A + L+ Sbjct: 1524 HVDILADIFSCIASHAQQLNTDTVLRRKFKRACSVQNLTEPQLLNFENEAYKSYMMFLQD 1583 Query: 192 VLSCVPLLTSHMIANQVGKDVVEDLARSLGYVISVTYPQKNNENQ 58 +++C P ++ + + +V + A+ + + T PQ+ + Q Sbjct: 1584 MVTCNPNVSKEL---DLESRLVTECAKIVKIYLKCTDPQQQEQQQ 1625 >At4g14160.2 68417.m02186 transport protein, putative similar to Swiss-Prot:Q15436 protein transport protein Sec23A [Homo sapiens] Length = 772 Score = 28.7 bits (61), Expect = 3.4 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +1 Query: 457 TIRPFVALFDNYHKNVIRPEFVTP-NEETEQTTYINTILATGPIRSLITFL 606 T++P++ LF + N+ R +FV N ++T Y +L I + I + Sbjct: 579 TLKPYLTLFPQFMFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNAIVMI 629 >At1g12460.1 68414.m01440 leucine-rich repeat transmembrane protein kinase, putative Length = 882 Score = 28.7 bits (61), Expect = 3.4 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +1 Query: 250 SYEDLLRQAQDSTTDDDLLRVSEEMFNADINNAFNYIQVNLQG 378 S D+L Q + S +DD ++ + + D+ N+FN I N QG Sbjct: 25 SERDILLQFKGSISDDPYNSLASWVSDGDLCNSFNGITCNPQG 67 >At5g15450.1 68418.m01808 heat shock protein 100, putative / HSP100, putative / heat shock protein clpB, putative / HSP100/ClpB, putative similar to HSP100/ClpB GI:9651530 [Phaseolus lunatus] Length = 968 Score = 27.9 bits (59), Expect = 5.9 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +1 Query: 94 DDIAQAAGQIFNNILPNLISNHVTGQQGNTAQNT 195 D+I +A G +FN L L VT QG T T Sbjct: 757 DEIEKAHGDVFNVFLQILDDGRVTDSQGRTVSFT 790 >At3g01290.1 68416.m00037 band 7 family protein similar to hypersensitive-induced response protein [Zea mays] GI:7716470; contains Pfam profile PF01145: SPFH domain / Band 7 family Length = 285 Score = 27.9 bits (59), Expect = 5.9 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 6/58 (10%) Frame = -1 Query: 240 RIVNDATDNCAYLLESVLSCVPLLTSHMI---ANQVGKDVVEDLARSL---GYVISVT 85 R+ N T AY+ + + +CVP L + N++ K V E+L +++ GY I T Sbjct: 89 RLSNPTTQIKAYVFDVIRACVPKLNLDDVFEQKNEIAKSVEEELDKAMTAYGYEILQT 146 >At5g60090.1 68418.m07534 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 398 Score = 27.5 bits (58), Expect = 7.8 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -1 Query: 600 SNEAPDGSRSKNSVDVSGLFRFFIRRNKLWSDHI 499 S+ A G+ + VDV LF R N LW +H+ Sbjct: 13 SSNAAQGNDENDEVDVERLFGNNERLNHLWRNHL 46 >At5g43935.1 68418.m05375 flavonol synthase, putative similar to flavonol synthase from Arabidopsis thaliana [SP|Q96330], Matthiola incana [SP|O04395]; contains Pfam profile PF03171 2OG-Fe(II) oxygenase superfamily Length = 293 Score = 27.5 bits (58), Expect = 7.8 Identities = 11/45 (24%), Positives = 23/45 (51%) Frame = -1 Query: 630 QLSNAFVD*ESNEAPDGSRSKNSVDVSGLFRFFIRRNKLWSDHIL 496 ++ F + ++E +R +S D+ G F ++ K W DH++ Sbjct: 63 EVGRQFFELPASEKESVTRPADSQDIEGFFSKDPKKLKAWDDHLI 107 >At2g16140.1 68415.m01850 expressed protein contains similarity to hypothetical proteins Length = 311 Score = 27.5 bits (58), Expect = 7.8 Identities = 17/67 (25%), Positives = 29/67 (43%) Frame = +1 Query: 151 SNHVTGQQGNTAQNTFQQIGTVVGGVVDYAKKKSYEDLLRQAQDSTTDDDLLRVSEEMFN 330 S + G + N Q+ + GV + SYE R+ D+D++ ++ E+FN Sbjct: 101 SPQLNGLRKRMQGNIKQRWAKINDGVCKFVG--SYEAASREKSSGQNDNDVISLAHEIFN 158 Query: 331 ADINNAF 351 D F Sbjct: 159 NDYGYKF 165 >At1g69780.1 68414.m08029 homeobox-leucine zipper protein 13 (HB-13) / HD-ZIP transcription factor 13 identical to homeobox gene 13 protein (GP:12325190) [Arabidopsis thaliana] Length = 294 Score = 27.5 bits (58), Expect = 7.8 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 5/65 (7%) Frame = +1 Query: 244 KKSYEDLLRQAQDSTTDDDLLRVSEEMFNADINNAFNYIQ---VNLQGKT--TPMSRNDE 408 +K Y+ L RQ ++DLL+ + A+I N Q +NL +T + +R+D Sbjct: 143 EKDYDTLKRQFDTLKAENDLLQTHNQKLQAEIMGLKNREQTESINLNKETEGSCSNRSDN 202 Query: 409 AQSNL 423 + NL Sbjct: 203 SSDNL 207 >At1g68400.1 68414.m07814 leucine-rich repeat transmembrane protein kinase, putative similar to receptor kinase GB:AAA33715 from [Petunia integrifolia] Length = 670 Score = 27.5 bits (58), Expect = 7.8 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 370 LQGKTTPMSRNDEAQSNLLNVPENVWSGPT 459 L T R DEA+++ LN PE V S PT Sbjct: 229 LSSDPTKPGRPDEAKASPLNKPETVPSSPT 258 >At1g12550.1 68414.m01455 oxidoreductase family protein similar to glyoxylate reductase from Homo sapiens (gi:6002730); contains Pfam D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain PF02826 Length = 323 Score = 27.5 bits (58), Expect = 7.8 Identities = 18/73 (24%), Positives = 32/73 (43%) Frame = +1 Query: 7 CAGTALDHTH*SNMKITLIFVVFLGVCHADDIAQAAGQIFNNILPNLISNHVTGQQGNTA 186 C +DH + K I + G +DD+A A + ++L + + + GN A Sbjct: 80 CTSVGIDHIDLAACKRRGIVITNAGNAFSDDVADCAVGLLISVLRRIPAADRYVRSGNWA 139 Query: 187 QNTFQQIGTVVGG 225 + Q+G+ V G Sbjct: 140 KFGDFQLGSKVSG 152 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,869,761 Number of Sequences: 28952 Number of extensions: 259601 Number of successful extensions: 691 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 691 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1295224128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -