BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b13r (744 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31528| Best HMM Match : DDHD (HMM E-Value=2e-29) 32 0.56 SB_56407| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_54569| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0018) 29 3.0 SB_17727| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-12) 29 3.0 SB_23474| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-12) 29 3.0 SB_51284| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_13470| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_31528| Best HMM Match : DDHD (HMM E-Value=2e-29) Length = 1123 Score = 31.9 bits (69), Expect = 0.56 Identities = 18/60 (30%), Positives = 34/60 (56%) Frame = +1 Query: 382 TNQEKNFQLLISCYSIITKKIANN*TKLLKNDYSIRNIDNYNNFSCTELTLPFILFKNNS 561 T+++ +F+++ + ++ K+ NN T++ KN + NI S TE+T IL NN+ Sbjct: 815 TSEDMDFEMMSTIKNLT--KMTNNTTEMTKNTTEMTNITTEMPNSTTEMTNNTILMTNNN 872 >SB_56407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2028 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = +1 Query: 385 NQEKNFQLLISCYSIITKKIANN*TKLLKNDYSIRNIDNYNNFS 516 N E+N +++ IIT+ I +N T+ + Y+++ ID+ N FS Sbjct: 847 NTEQN-GIILGYKIIITETIQSNKTRSFSSFYTVQQIDHLNKFS 889 >SB_54569| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0018) Length = 292 Score = 29.5 bits (63), Expect = 3.0 Identities = 22/45 (48%), Positives = 26/45 (57%), Gaps = 5/45 (11%) Frame = +1 Query: 394 KNFQLLISCYSIITKK---IANN*TKLLKNDYSIRNID--NYNNF 513 KNF LL +I K IA TKL NDYS++NI+ NYN F Sbjct: 99 KNFDLLEDILYLIDSKPQIIAVTETKL--NDYSVKNINFKNYNFF 141 >SB_17727| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-12) Length = 648 Score = 29.5 bits (63), Expect = 3.0 Identities = 22/45 (48%), Positives = 26/45 (57%), Gaps = 5/45 (11%) Frame = +1 Query: 394 KNFQLLISCYSIITKK---IANN*TKLLKNDYSIRNID--NYNNF 513 KNF LL +I K IA TKL NDYS++NI+ NYN F Sbjct: 99 KNFDLLEDILYLIDSKPQIIAVTETKL--NDYSVKNINFKNYNFF 141 >SB_23474| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-12) Length = 623 Score = 29.5 bits (63), Expect = 3.0 Identities = 22/45 (48%), Positives = 26/45 (57%), Gaps = 5/45 (11%) Frame = +1 Query: 394 KNFQLLISCYSIITKK---IANN*TKLLKNDYSIRNID--NYNNF 513 KNF LL +I K IA TKL NDYS++NI+ NYN F Sbjct: 301 KNFDLLEDILYLIDSKPQIIAVTETKL--NDYSVKNINFKNYNFF 343 >SB_51284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -2 Query: 221 CHWRAWNLALT*GSVTKVSRFDTYTNWMTSELGLNPKIHTY 99 CHW+ N T GSV+ F+ + N + L P + Y Sbjct: 475 CHWKCVNRGTTQGSVSSPYLFNIFINDLEINLCNQPALFKY 515 >SB_13470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1483 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 352 YYRVFYLIKNTNQEKNFQLLISCYSIITKKI 444 +Y VFY +K K ++ SC + I +K+ Sbjct: 759 FYEVFYFLKGVRYPKKCAIIPSCVNYIQRKL 789 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,866,613 Number of Sequences: 59808 Number of extensions: 305633 Number of successful extensions: 652 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2010148439 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -