BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10b13r (744 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 25 2.5 AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 24 5.7 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 25.0 bits (52), Expect = 2.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 376 KNTNQEKNFQLLISCYSIITKKIANN*TKL 465 +N ++E NF+LL Y K +AN KL Sbjct: 742 RNNDREANFRLLEDAYQSAKKTLANVEKKL 771 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 23.8 bits (49), Expect = 5.7 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +1 Query: 289 CCNYVTYYFLLRKY 330 CCN +TY F+ R++ Sbjct: 517 CCNPITYCFMNRRF 530 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 630,475 Number of Sequences: 2352 Number of extensions: 11555 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -